From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003268000
  • symbol?: qoxC
  • description?: quinol oxidase subunit 3

      descriptions from strain specific annotations:

    • quinol oxidase subunit 3
    • quinol oxidase subunit III
    • quinol oxidase polypeptide III QoxC
    • cytochrome c oxidase subunit III
    • quinol oxidase polypeptide III
    • quinol oxidase, subunit III
    • cytochrome aa3 quinol oxidase, subunit III
    • cytochrome aa3 quinol oxidase subunit III
    • putative quinol oxidase polypeptide III
  • strand?: -
  • coordinates?: 3645290..3645895
  • synteny block?: BlockID0023520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1068 (qoxC)
    N315:
    SA0911 (qoxC)
    NCTC8325:
    Newman:
    NWMN_0928 (qoxC)
    USA300_FPR3757:
    04-02981:
    SA2981_1013 (qoxC)
    08BA02176:
    C248_1084 (qoxC)
    11819-97:
    MS7_1016 (qoxC)
    71193:
    ST398NM01_1056
    ECT-R 2:
    ECTR2_914 (qoxC)
    ED133:
    SAOV_1005c
    ED98:
    SAAV_1023 (qoxC)
    HO 5096 0412:
    SAEMRSA15_08900 (qoxC)
    JH1:
    SaurJH1_1141
    JH9:
    SaurJH9_1118
    JKD6008:
    SAA6008_01014 (qoxC)
    JKD6159:
    SAA6159_00915 (qoxC)
    LGA251:
    SARLGA251_09730 (qoxC)
    M013:
    M013TW_0990
    MRSA252:
    SAR1032 (qoxC)
    MSHR1132:
    SAMSHR1132_09070
    MSSA476:
    SAS0994
    Mu3:
    SAHV_1051 (qoxC)
    Mu50:
    SAV1059 (qoxC)
    MW2:
    MW0942 (qoxC)
    RF122:
    SAB0925c (qoxC)
    ST398:
    SAPIG1056 (qoxC)
    T0131:
    SAT0131_01094 (geh)
    TCH60:
    HMPREF0772_12175 (qoxC)
    TW20:
    SATW20_10550 (qoxC)
    USA300_TCH1516:
    USA300HOU_1003 (qoxC)
    VC40:
    SAVC_04460

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL
    N315            MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL
    NCTC8325        MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL
    Newman          MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL
    USA300_FPR3757  MSHDTNTIDSRTHEGELNKLGFWIFITAEFALFGTLFATLLTLQHGGDYAGKMTTELFEL
                    ************************************************************

    COL             PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE
    N315            PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE
    NCTC8325        PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE
    Newman          PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE
    USA300_FPR3757  PLVLIMTFALLFSSYTCGIAIYYMRQEKQKLMMFWMIITLLLGLVFVGFEIYEFAHYASE
                    ************************************************************

    COL             GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF
    N315            GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF
    NCTC8325        GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF
    Newman          GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF
    USA300_FPR3757  GVNPTIGSYWSSFFILLGTHGCHVSLGIVWAICLLIQIQRRGLDKYNAPKLFIVSLYWHF
                    ************************************************************

    COL             LDVVWVFIFTAVYMIGMVYSG
    N315            LDVVWVFIFTAVYMIGMVYSG
    NCTC8325        LDVVWVFIFTAVYMIGMVYSG
    Newman          LDVVWVFIFTAVYMIGMVYSG
    USA300_FPR3757  LDVVWVFIFTAVYMIGMVYSG
                    *********************