From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003289000
  • symbol?: thiX
  • description?: energy-coupling factor transporter transmembrane protein EcfT

      descriptions from strain specific annotations:

    • energy-coupling factor transporter transmembrane protein EcfT
    • cobalt transport family protein
    • cobalt transport protein
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC transporter ATP-binding protein
    • hydroxymethylpyrimidine transport system permease protein
    • membrane transporter
    • membrane transport protein
    • putative cobalt transport protein
    • transmembrane component YkoC of energizing module of thiamin-regulated ECF transporter
    • Transmembrane component YkoC of energizing module of thiamin-regulated ECF transporter for HydroxyMethylPyrimidine
  • strand?: -
  • coordinates?: 3664040..3664846
  • synteny block?: BlockID0023730
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1031
    08BA02176:
    C248_1101
    11819-97:
    MS7_1033
    71193:
    ST398NM01_1073
    ECT-R 2:
    ECTR2_931
    ED133:
    SAOV_1020c
    ED98:
    SAAV_1040
    HO 5096 0412:
    SAEMRSA15_09060
    JH1:
    SaurJH1_1157
    JH9:
    SaurJH9_1135
    JKD6008:
    SAA6008_01031 (ykoC)
    JKD6159:
    SAA6159_00931 (ykoC)
    LGA251:
    SARLGA251_09890 (ykoC)
    M013:
    M013TW_1007
    MRSA252:
    SAR1049
    MSHR1132:
    SAMSHR1132_09230
    MSSA476:
    SAS1011
    Mu3:
    SAHV_1067
    Mu50:
    SAV1075
    MW2:
    MW0958
    RF122:
    SAB0942c
    ST398:
    SAPIG1073
    T0131:
    SAT0131_01112
    TCH60:
    HMPREF0772_12158
    TW20:
    SATW20_10710 (ykoC)
    USA300_TCH1516:
    USA300HOU_1019
    VC40:
    SAVC_04540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----MYEQWKVRQSFVDDVNIITKLFLGIILFFFIIFVHNFDFMLYITILMLVFLLMFN
    N315            -----MYEQWKVRQSFVDDVNIITKLFLGIILFFFIIFVHNFDFMLYITILMLVFLLMFN
    NCTC8325        -----MYEQWKVRQSFVDDVNIITKLFLGIILFFFIIFVHNFDFMLYITILMLVFLLMFN
    Newman          MMVIRMYEQWKVRQSFVDDVNIITKLFLGIILFFFIIFVHNFDFMLYITILMLVFLLMFN
    USA300_FPR3757  -----MYEQWKVRQSFVDDVNIITKLFLGIILFFFIIFVHNFDFMLYITILMLVFLLMFN
                         *******************************************************

    COL             GTQFKITAIFITISIGFALLSSLFMILYGNGSHTILKFGFIHITTESLVRGLHVSLRTIA
    N315            GTQFKITAIFITISIGFALLSSLFMILYGNGSHTILKFGFIHITTESLVRGLHVSLRTIA
    NCTC8325        GTQFKITAIFITISIGFALLSSLFMILYGNGSHTILKFGFIHITTESLVRGLHVSLRTIA
    Newman          GTQFKITAIFITISIGFALLSSLFMILYGNGSHTILKFGFIHITTESLVRGLHVSLRTIA
    USA300_FPR3757  GTQFKITAIFITISIGFALLSSLFMILYGNGSHTILKFGFIHITTESLVRGLHVSLRTIA
                    ************************************************************

    COL             ISFFGILIALTSQVVMIFYSLMQHLKVKSKVAYAFMAAIRMIPLMISSLIQLRRSLKMRY
    N315            ISFFGILIALTSQVVMIFYSLMQHLKVKSKVAYAFMAAIRMIPLMISSLIQLRRSLKMRY
    NCTC8325        ISFFGILIALTSQVVMIFYSLMQHLKVKSKVAYAFMAAIRMIPLMISSLIQLRRSLKMRY
    Newman          ISFFGILIALTSQVVMIFYSLMQHLKVKSKVAYAFMAAIRMIPLMISSLIQLRRSLKMRY
    USA300_FPR3757  ISFFGILIALTSQVVMIFYSLMQHLKVKSKVAYAFMAAIRMIPLMISSLIQLRRSLKMRY
                    ************************************************************

    COL             QMIDAANYRGLKRFKHLIIPLLSQNIRKAHQLSVAMESKGFRDGPRTYYYNVPFSYKDII
    N315            QMIDAANYRGLKRFKHLIIPLLSQNIRKAHQLSVAMESKGFRDGPRTYYYNVPFSYKDII
    NCTC8325        QMIDAANYRGLKRFKHLIIPLLSQNIRKAHQLSVAMESKGFRDGPRTYYYNVPFSYKDII
    Newman          QMIDAANYRGLKRFKHLIIPLLSQNIRKAHQLSVAMESKGFRDGPRTYYYNVPFSYKDII
    USA300_FPR3757  QMIDAANYRGLKRFKHLIIPLLSQNIRKAHQLSVAMESKGFRDGPRTYYYNVPFSYKDII
                    ************************************************************

    COL             FIIVLIAIITMAYYCSITLPITGIDDVRLGRVG
    N315            FIIVLIAIITMAYYCSITLPITGIDDVRLGRVG
    NCTC8325        FIIVLIAIITMAYYCSITLPITGIDDVRLGRVG
    Newman          FIIVLIAIITMAYYCSITLPITGIDDVRLGRVG
    USA300_FPR3757  FIIVLIAIITMAYYCSITLPITGIDDVRLGRVG
                    *********************************