From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003306000
  • symbol?: cydA
  • description?: cytochrome ubiquinol oxidase subunit I

      descriptions from strain specific annotations:

    • cytochrome ubiquinol oxidase subunit I
    • cytochrome d ubiquinol oxidase subunit I
    • cytochrome D ubiquinol oxidase, subunit I
    • bacterial Cytochrome Ubiquinol Oxidase family protein
    • cytochrome bd ubiquinol oxidase, subunit I
    • cytochrome bd ubiquinol oxidase subunit I
    • cytochrome D ubiquinol oxidase subunit 1-like protein
    • cytochrome ubiquinol oxidase
    • Cytochrome Ubiquinol Oxidase family protein
    • putative cytochrome ubiquinol oxidase
  • strand?: +
  • coordinates?: 3676622..3677983
  • synteny block?: BlockID0023900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1094 (cydA)
    N315:
    NCTC8325:
    Newman:
    NWMN_0952 (cydA)
    USA300_FPR3757:
    04-02981:
    SA2981_1042
    08BA02176:
    C248_1112
    11819-97:
    MS7_1043
    71193:
    ST398NM01_1083
    ECT-R 2:
    ECTR2_941
    ED133:
    SAOV_1030
    ED98:
    SAAV_1051 (cydA)
    HO 5096 0412:
    SAEMRSA15_09160
    JH1:
    SaurJH1_1168
    JH9:
    SaurJH9_1146
    JKD6008:
    SAA6008_01041
    JKD6159:
    SAA6159_00942
    LGA251:
    SARLGA251_09990
    M013:
    M013TW_1018
    MRSA252:
    SAR1059
    MSHR1132:
    SAMSHR1132_09330
    MSSA476:
    SAS1021
    Mu3:
    SAHV_1078
    Mu50:
    SAV1086
    MW2:
    MW0968
    RF122:
    SAB0952
    ST398:
    SAPIG1083
    T0131:
    SAT0131_01122
    TCH60:
    HMPREF0772_12147 (cydA)
    TW20:
    SATW20_10810
    USA300_TCH1516:
    USA300HOU_1028 (cydA)
    VC40:
    SAVC_04590

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDTVEISRFLTAMTLAVHIIFATIGVGMPLMFAIAEFLGIRKNDLQYIAMAKRWAKAYTI
    N315            MDTVEISRFLTAMTLAVHIIFATIGVGMPLMFAIAEFLGIRKNDLQYIAMAKRWAKAYTI
    NCTC8325        MDTVEISRFLTAMTLAVHIIFATIGVGMPLMFAIAEFLGIRKNDLQYIAMAKRWAKAYTI
    Newman          MDTVEISRFLTAMTLAVHIIFATIGVGMPLMFAIAEFLGIRKNDLQYIAMAKRWAKAYTI
    USA300_FPR3757  MDTVEISRFLTAMTLAVHIIFATIGVGMPLMFAIAEFLGIRKNDLQYIAMAKRWAKAYTI
                    ************************************************************

    COL             TVAVGVVTGTIIGLQLSLIWPTFMEMGGHVIALPLFMETFAFFFEAIFLSIYLYTWDRFK
    N315            TVAVGVVTGTIIGLQLSLIWPTFMEMGGHVIALPLFMETFAFFFEAIFLSIYLYTWDRFK
    NCTC8325        TVAVGVVTGTIIGLQLSLIWPTFMEMGGHVIALPLFMETFAFFFEAIFLSIYLYTWDRFK
    Newman          TVAVGVVTGTIIGLQLSLIWPTFMEMGGHVIALPLFMETFAFFFEAIFLSIYLYTWDRFK
    USA300_FPR3757  TVAVGVVTGTIIGLQLSLIWPTFMEMGGHVIALPLFMETFAFFFEAIFLSIYLYTWDRFK
                    ************************************************************

    COL             NKWTHFLISIPVIIGGSFSAFFITSVNSFMNTPAGFELKNGKMVNVQPIEAMFNPSFIVR
    N315            NKWTHFLISIPVIIGGSFSAFFITSVNSFMNTPAGFELKNGKMVNVQPIEAMFNPSFIVR
    NCTC8325        NKWTHFLISIPVIIGGSFSAFFITSVNSFMNTPAGFELKNGKMVNVQPIEAMFNPSFIVR
    Newman          NKWTHFLISIPVIIGGSFSAFFITSVNSFMNTPAGFELKNGKMVNVQPIEAMFNPSFIVR
    USA300_FPR3757  NKWTHFLISIPVIIGGSFSAFFITSVNSFMNTPAGFELKNGKMVNVQPIEAMFNPSFIVR
                    ************************************************************

    COL             SFHVITTAGMTMAFVIASIAAFKLLRNRQPKDTVYHKKALKMSMIVGFFSTLLSMLAGDL
    N315            SFHVITTAGMTMAFVIASIAAFKLLRNRQPKDTVYHKKALKMSMIVGFFSTLLSMLAGDL
    NCTC8325        SFHVITTAGMTMAFVIASIAAFKLLRNRQPKDTVYHKKALKMSMIVGFFSTLLSMLAGDL
    Newman          SFHVITTAGMTMAFVIASIAAFKLLRNRQPKDTVYHKKALKMSMIVGFFSTLLSMLAGDL
    USA300_FPR3757  SFHVITTAGMTMAFVIASIAAFKLLRNRQPKDTVYHKKALKMSMIVGFFSTLLSMLAGDL
                    ************************************************************

    COL             SAKFLHKFQPEKLAAYEWHFDTSSHAKLLLFGVLDEKTQQVKGAIELPGLLSFLADNSVK
    N315            SAKFLHKFQPEKLAAYEWHFDTSSHAKLLLFGVLDEKTQQVKGAIELPGLLSFLADNSVK
    NCTC8325        SAKFLHKFQPEKLAAYEWHFDTSSHAKLLLFGVLDEKTQQVKGAIELPGLLSFLADNSVK
    Newman          SAKFLHKFQPEKLAAYEWHFDTSSHAKLLLFGVLDEKTQQVKGAIELPGLLSFLADNSVK
    USA300_FPR3757  SAKFLHKFQPEKLAAYEWHFDTSSHAKLLLFGVLDEKTQQVKGAIELPGLLSFLADNSVK
                    ************************************************************

    COL             TKVQGLNDFPKSLHPPMIVHYFFDLMVTMGILCFVISGVYVLTLMFKKLRKFSTHKWMLY
    N315            TKVQGLNDFPKSLHPPMIVHYFFDLMVTMGILCFVISGVYVLTLMFKKLRKFSTHKWMLY
    NCTC8325        TKVQGLNDFPKSLHPPMIVHYFFDLMVTMGILCFVISGVYVLTLMFKKLRKFSTHKWMLY
    Newman          TKVQGLNDFPKSLHPPMIVHYFFDLMVTMGILCFVISGVYVLTLMFKKLRKFSTHKWMLY
    USA300_FPR3757  TKVQGLNDFPKSLHPPMIVHYFFDLMVTMGILCFVISGVYVLTLMFKKLRKFSTHKWMLY
                    ************************************************************

    COL             GILLTGPASMLAIEFGWFLTEMGRQPWIVRGYMRVAEAATQAGGITFVTILFGILYIILM
    N315            GILLTGPASMLAIEFGWFLTEMGRQPWIVRGYMRVAEAATQAGGITFVTILFGILYIILM
    NCTC8325        GILLTGPASMLAIEFGWFLTEMGRQPWIVRGYMRVAEAATQAGGITFVTILFGILYIILM
    Newman          GILLTGPASMLAIEFGWFLTEMGRQPWIVRGYMRVAEAATQAGGITFVTILFGILYIILM
    USA300_FPR3757  GILLTGPASMLAIEFGWFLTEMGRQPWIVRGYMRVAEAATQAGGITFVTILFGILYIILM
                    ************************************************************

    COL             YTCAYVLIRMFKNKPAYEDVNRLAKKQGGEIEK
    N315            YTCAYVLIRMFKNKPAYEDVNRLAKKQGGEIEK
    NCTC8325        YTCAYVLIRMFKNKPAYEDVNRLAKKQGGEIEK
    Newman          YTCAYVLIRMFKNKPAYEDVNRLAKKQGGEIEK
    USA300_FPR3757  YTCAYVLIRMFKNKPAYEDVNRLAKKQGGEIEK
                    *********************************