From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003307000
  • symbol?: cydB
  • description?: cytochrome D ubiquinol oxidase subunit II-like protein

      descriptions from strain specific annotations:

    • cytochrome D ubiquinol oxidase subunit II-like protein
    • cytochrome bd-type quinol oxidase subunit 2-like protein
    • cytochrome d ubiquinol oxidase subunit II
    • cytochrome d ubiquinol oxidase, subunit II
    • cytochrome oxidase subunit II family protein
    • putative cytochrome D ubiquinol oxidase, subunit II
  • strand?: +
  • coordinates?: 3677980..3678999
  • synteny block?: BlockID0023910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1095 (cydB)
    N315:
    NCTC8325:
    Newman:
    NWMN_0953 (cydB)
    USA300_FPR3757:
    04-02981:
    SA2981_1043
    08BA02176:
    C248_1113
    11819-97:
    MS7_1044
    71193:
    ST398NM01_1084
    ECT-R 2:
    ECTR2_942
    ED133:
    SAOV_1031
    ED98:
    SAAV_1052 (cydB)
    HO 5096 0412:
    SAEMRSA15_09170
    JH1:
    SaurJH1_1169
    JH9:
    SaurJH9_1147
    JKD6008:
    SAA6008_01042 (cydB)
    JKD6159:
    SAA6159_00943 (cydB)
    LGA251:
    SARLGA251_10000
    M013:
    M013TW_1019
    MRSA252:
    SAR1060
    MSHR1132:
    SAMSHR1132_09340
    MSSA476:
    SAS1022
    Mu3:
    SAHV_1079
    Mu50:
    SAV1087
    MW2:
    MW0969
    RF122:
    SAB0953
    ST398:
    SAPIG1084
    T0131:
    SAT0131_01123
    TCH60:
    HMPREF0772_12146 (cydB)
    TW20:
    SATW20_10820
    USA300_TCH1516:
    USA300HOU_1029 (cydB)
    VC40:
    SAVC_04595

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIYAFIGITVLWLFLFCYIIIASIDFGAGFFALHSKLTGDEKKINHLISRYLNPVWEVTN
    N315            MIYAFIGITVLWLFLFCYIIIASIDFGAGFFALHSKLTGDEKKINHLISRYLNPVWEVTN
    NCTC8325        MIYAFIGITVLWLFLFCYIIIASIDFGAGFFALHSKLTGDEKKINHLISRYLNPVWEVTN
    Newman          MIYAFIGITVLWLFLFCYIIIASIDFGAGFFALHSKLTGDEKKINHLISRYLNPVWEVTN
    USA300_FPR3757  MIYAFIGITVLWLFLFCYIIIASIDFGAGFFALHSKLTGDEKKINHLISRYLNPVWEVTN
                    ************************************************************

    COL             VFFVFFFVGFVGFFPESIKYLGTVLLIPGSIALIMISLRNSFYAFENYGQDTKLAWMIMY
    N315            VFFVFFFVGFVGFFPESIKYLGTVLLVPGSIALIMISLRNSFYAFENYGQDTKLAWMIMY
    NCTC8325        VFFVFFFVGFVGFFPESIKYLGTVLLIPGSIALIMISLRNSFYAFENYGQDTKLAWMIMY
    Newman          VFFVFFFVGFVGFFPESIKYLGTVLLIPGSIALIMISLRNSFYAFENYGQDTKLAWMIMY
    USA300_FPR3757  VFFVFFFVGFVGFFPESIKYLGTVLLIPGSIALIMISLRNSFYAFENYGQDTKLAWMIMY
                    **************************:*********************************

    COL             GVSGLLIPASLSTALTITEGGYINVRNNVIDLDWVQLLLSPFAWSVVFLAIISVLYISSG
    N315            GVSGLLIPASLSTALTITEGGYINVRNNVIDLDWVQLLLSPFAWSVVFLAIISVLYISSG
    NCTC8325        GVSGLLIPASLSTALTITEGGYINVRNNVIDLDWVQLLLSPFAWSVVFLAIISVLYISSG
    Newman          GVSGLLIPASLSTALTITEGGYINVRNNVIDLDWVQLLLSPFAWSVVFLAIISVLYISSG
    USA300_FPR3757  GVSGLLIPASLSTALTITEGGYINVRNNVIDLDWVQLLLSPFAWSVVFLAIISVLYISSG
                    ************************************************************

    COL             FLTYYAKKANDEPAYNLTRQWHIFLGPPMIIICLFVFLSLRIQNSEHFYSAVFDYWWMFG
    N315            FLTYYAKKANDEPAYNLTRQWHIFLGPPMIIICLFVFLSLRIQNSEHFYSAVFDYWWMFA
    NCTC8325        FLTYYAKKANDEPAYNLTRQWHIFLGPPMIIICLFVFLSLRIQNSEHFYSAVFDYWWMFG
    Newman          FLTYYAKKANDEPAYNLTRQWHIFLGPPMIIICLFVFLSLRIQNSEHFYSAVFDYWWMFG
    USA300_FPR3757  FLTYYAKKANDEPAYNLTRQWHIFLGPPMIIICLFVFLSLRIQNSEHFYSAVFDYWWMFG
                    ***********************************************************.

    COL             ISFLFFALASLLTFFKKKHGLAFVFVILQMMFAFFGYGISKLPYLLYPFVKITDAYVNPE
    N315            ISFLFFALASLLTFFKKKHGLAFVFVILQMMFAFFGYGISKLPYLLYPFVKITDAYVNPE
    NCTC8325        ISFLFFALASLLTFFKKKHGLAFVFVILQMMFAFFGYGISKLPYLLYPFVKITDAYVNPE
    Newman          ISFLFFALASLLTFFKKKHGLAFVFVILQMMFAFFGYGISKLPYLLYPFVKITDAYVNPE
    USA300_FPR3757  ISFLFFALASLLTFFKKKHGLAFVFVILQMMFAFFGYGISKLPYLLYPFVKITDAYVNPE
                    ************************************************************

    COL             MGWTLVIVFILGLLLLLPSLILLLRLFVFDKEYVEGKKS
    N315            MGWTLVIVFILGLLLLLPSLILLLRLFVFDKEYVEGKKS
    NCTC8325        MGWTLVIVFILGLLLLLPSLILLLRLFVFDKEYVEGKKS
    Newman          MGWTLVIVFILGLLLLLPSLILLLRLFVFDKEYVEGKKS
    USA300_FPR3757  MGWTLVIVFILGLLLLLPSLILLLRLFVFDKEYVEGKKS
                    ***************************************