From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003318000
  • symbol?: pdhB
  • description?: pyruvate dehydrogenase E1 component subunit beta

      descriptions from strain specific annotations:

    • pyruvate dehydrogenase E1 component subunit beta
    • pyruvate dehydrogenase E1 component beta subunit
    • pyruvate dehydrogenase complex, E1 component, pyruvate dehydrogenase beta subunit
    • transketolase domain-containing protein
    • pyruvate dehydrogenase E1 component, beta subunit
    • pyruvate dehydrogenase complex E1 component, beta subunit
    • putative pyruvate dehydrogenase E1 component,beta subunit
    • putative pyruvate dehydrogenase E1 component subunit beta
    • pyruvate dehydrogenase E1 component subunit beta (Scomplex, 36 kDa subunit)
    • pyruvate dehydrogenase (acetyl-transferring) beta subunit
    • pyruvate dehydrogenase complex E1 component subunit beta
    • pyruvate dehydrogenase complex E1 component beta subunit
  • strand?: +
  • coordinates?: 3685579..3686556
  • synteny block?: BlockID0024020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1103 (pdhB)
    N315:
    SA0944 (pdhB)
    NCTC8325:
    Newman:
    NWMN_0960 (phdB)
    USA300_FPR3757:
    04-02981:
    SA2981_1051 (pdhB)
    08BA02176:
    C248_1121 (pdhB)
    11819-97:
    MS7_1051 (pdhB)
    71193:
    ST398NM01_1091
    ECT-R 2:
    ECTR2_949
    ED133:
    SAOV_1038
    ED98:
    SAAV_1059 (pdhB)
    HO 5096 0412:
    SAEMRSA15_09240 (pdhB)
    JH1:
    SaurJH1_1176
    JH9:
    SaurJH9_1154
    JKD6008:
    SAA6008_01049 (pdhB)
    JKD6159:
    SAA6159_00950 (pdhB)
    LGA251:
    SARLGA251_10070 (pdhB)
    M013:
    M013TW_1026
    MRSA252:
    SAR1068 (pdhB)
    MSHR1132:
    SAMSHR1132_09410
    MSSA476:
    SAS1029
    Mu3:
    SAHV_1086 (phdB)
    Mu50:
    SAV1094 (phdB)
    MW2:
    MW0977 (phdB)
    RF122:
    SAB0960 (pdhB)
    ST398:
    SAPIG1091
    T0131:
    SAT0131_01131
    TCH60:
    HMPREF0772_12138 (pdhB)
    TW20:
    SATW20_10890 (pdhB)
    USA300_TCH1516:
    USA300HOU_1037 (phdB)
    VC40:
    SAVC_04630

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAQMTMVQAINDALKTELKNDQDVLIFGEDVGVNGGVFRVTEGLQKEFGEDRVFDTPLAE
    N315            MAQMTMVQAINDALKTELKNDQDVLIFGEDVGVNGGVFRVTEGLQKEFGEDRVFDTPLAE
    NCTC8325        MAQMTMVQAINDALKTELKNDQDVLIFGEDVGVNGGVFRVTEGLQKEFGEDRVFDTPLAE
    Newman          MAQMTMVQAINDALKTELKNDQDVLIFGEDVGVNGGVFRVTEGLQKEFGEDRVFDTPLAE
    USA300_FPR3757  MAQMTMVQAINDALKTELKNDQDVLIFGEDVGVNGGVFRVTEGLQKEFGEDRVFDTPLAE
                    ************************************************************

    COL             SGIGGLAMGLAVEGFRPVMEVQFLGFVFEVFDAIAGQIARTRFRSGGTKTAPVTIRGPFG
    N315            SGIGGLAMGLAVEGFRPVMEVQFLGFVFEVFDAIAGQIARTRFRSGGTKTAPVTIRSPFG
    NCTC8325        SGIGGLAMGLAVEGFRPVMEVQFLGFVFEVFDAIAGQIARTRFRSGGTKTAPVTIRSPFG
    Newman          SGIGGLAMGLAVEGFRPVMEVQFLGFVFEVFDAIAGQIARTRFRSGGTKTAPVTIRSPFG
    USA300_FPR3757  SGIGGLAMGLAVEGFRPVMEVQFLGFVFEVFDAIAGQIARTRFRSGGTKTAPVTIRSPFG
                    ********************************************************.***

    COL             GGVHTPELHADNLEGILAQSPGLKVVIPSGPYDAKGLLISSIRSNDPVVYLEHMKLYRSF
    N315            GGVHTPELHADNLEGILAQSPGLKVVIPSGPYDAKGLLISSIRSNDPVVYLEHMKLYRSF
    NCTC8325        GGVHTPELHADNLEGILAQSPGLKVVIPSGPYDAKGLLISSIRSNDPVVYLEHMKLYRSF
    Newman          GGVHTPELHADNLEGILAQSPGLKVVIPSGPYDAKGLLISSIRSNDPVVYLEHMKLYRSF
    USA300_FPR3757  GGVHTPELHADNLEGILAQSPGLKVVIPSGPYDAKGLLISSIRSNDPVVYLEHMKLYRSF
                    ************************************************************

    COL             REEVPEEEYTIDIGKANVKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQ
    N315            REEVPEEEYTIDIGKANVKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQ
    NCTC8325        REEVPEEEYTIDIGKANVKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQ
    Newman          REEVPEEEYTIDIGKANVKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQ
    USA300_FPR3757  REEVPEEEYTIDIGKANVKKEGNDISIITYGAMVQESMKAAEELEKDGYSVEVIDLRTVQ
                    ************************************************************

    COL             PIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYP
    N315            PIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYP
    NCTC8325        PIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYP
    Newman          PIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYP
    USA300_FPR3757  PIDVDTIVASVEKTGRAVVVQEAQRQAGVGAAVVAELSERAILSLEAPIGRVAAADTIYP
                    ************************************************************

    COL             FTQAENVWLPNKNDIIEKAKETLEF
    N315            FTQAENVWLPNKNDIIEKAKETLEF
    NCTC8325        FTQAENVWLPNKNDIIEKAKETLEF
    Newman          FTQAENVWLPNKNDIIEKAKETLEF
    USA300_FPR3757  FTQAENVWLPNKNDIIEKAKETLEF
                    *************************