From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003319000
  • symbol?: pdhC
  • description?: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

      descriptions from strain specific annotations:

    • dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
    • branched-chain alpha-keto acid dehydrogenase subunit E2
    • branched-chain alpha-keto acid dehydrogenase E2
    • branched-chain alpha-keto acid dehydrogenase E2 subunit
    • Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
    • dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex (E2) (Dihydrolipoamideacetyltransferase component of pyruvate dehydrogenase complex)
    • pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
    • pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase
  • strand?: +
  • coordinates?: 3686647..3687939
  • synteny block?: BlockID0024030
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1104 (pdhC)
    N315:
    SA0945 (pdhC)
    NCTC8325:
    Newman:
    NWMN_0961 (pdhC)
    USA300_FPR3757:
    04-02981:
    SA2981_1052 (pdhC)
    08BA02176:
    C248_1122 (pdhC)
    11819-97:
    MS7_1052 (pdhC)
    71193:
    ST398NM01_1092
    ECT-R 2:
    ECTR2_950
    ED133:
    SAOV_1039
    ED98:
    SAAV_1060
    HO 5096 0412:
    SAEMRSA15_09250 (pdhC)
    JH1:
    SaurJH1_1177
    JH9:
    SaurJH9_1155
    JKD6008:
    SAA6008_01050 (pdhC)
    JKD6159:
    SAA6159_00951 (pdhC)
    LGA251:
    SARLGA251_10080 (pdhC)
    M013:
    M013TW_1027
    MRSA252:
    SAR1069 (pdhC)
    MSHR1132:
    SAMSHR1132_09420
    MSSA476:
    SAS1030
    Mu3:
    SAHV_1087 (pdhC)
    Mu50:
    SAV1095 (pdhC)
    MW2:
    MW0978 (pdhC)
    RF122:
    SAB0961 (pdhC)
    ST398:
    SAPIG1092
    T0131:
    SAT0131_01132
    TCH60:
    HMPREF0772_12137 (pdhC)
    TW20:
    SATW20_10900 (pdhC)
    USA300_TCH1516:
    USA300HOU_1038 (pdhC)
    VC40:
    SAVC_04635

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVM
    N315            MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVM
    NCTC8325        MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPASGTVEEVM
    Newman          MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVM
    USA300_FPR3757  MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTVEEVM
                    ***************************************************.********

    COL             VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDE
    N315            VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDE
    NCTC8325        VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDE
    Newman          VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDE
    USA300_FPR3757  VEEGTVAVVGDVIVKIDAPDAEDMQFKGHDDDSSSKEEPAKEEAPAEQAPVATQTEEVDE
                    ************************************************************

    COL             NRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASATSE
    N315            NRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASATSE
    NCTC8325        NRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASATSE
    Newman          NRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASATSE
    USA300_FPR3757  NRTVKAMPSVRKYAREKGVNIKAVSGSGKNGRITKEDVDAYLNGGAPTASNESAASATSE
                    ************************************************************

    COL             EVAETPAAPAAVTLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
    N315            EVAETPAAPAAVSLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
    NCTC8325        EVAETPAAPAAVTLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
    Newman          EVAETPAAPAAVTLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
    USA300_FPR3757  EVAETPAAPAAVTLEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQALWDH
                    ************:***********************************************

    COL             RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
    N315            RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
    NCTC8325        RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
    Newman          RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
    USA300_FPR3757  RKKFKEIAAEQGTKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGIAADT
                    ************************************************************

    COL             DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
    N315            DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
    NCTC8325        DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
    Newman          DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
    USA300_FPR3757  DRGLLVPVVKHADRKSIFQISDEINELAVKARDGKLTADEMKGATCTISNIGSAGGQWFT
                    ************************************************************

    COL             PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
    N315            PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
    NCTC8325        PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
    Newman          PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
    USA300_FPR3757  PVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHIKRLL
                    ************************************************************

    COL             NNPELLLMEG
    N315            NNPELLLMEG
    NCTC8325        NNPELLLMEG
    Newman          NNPELLLMEG
    USA300_FPR3757  NNPELLLMEG
                    **********