From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003331000
  • symbol?: mntH
  • description?: manganese transport protein MntH

      descriptions from strain specific annotations:

    • manganese transport protein MntH
    • divalent metal cation transporter
    • metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family protein
    • metal ion transporter, metal ion family protein
    • mn2+/fe2+ transporter, nramp family
    • Mn2+/Fe2+ transporter NRAMP family protein
    • NRAMP family metal ion transporter
    • putative manganese transport protein
    • truncated manganese transport protein MntH
  • strand?: -
  • coordinates?: 3697816..3699168
  • synteny block?: BlockID0024150
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1062 (mntH)
    08BA02176:
    C248_1132
    11819-97:
    MS7_1062
    71193:
    ST398NM01_1102
    ECT-R 2:
    ECTR2_960
    ED133:
    SAOV_1049c
    ED98:
    SAAV_1071
    HO 5096 0412:
    SAEMRSA15_09350
    JH1:
    SaurJH1_1187
    JH9:
    SaurJH9_1165
    JKD6008:
    SAA6008_01060
    JKD6159:
    SAA6159_00961
    LGA251:
    SARLGA251_10180
    M013:
    M013TW_1037
    MRSA252:
    SAR1079
    MSHR1132:
    SAMSHR1132_09520
    MSSA476:
    SAS1040
    Mu3:
    SAHV_1097
    Mu50:
    SAV1105
    MW2:
    MW0988
    RF122:
    SAB0971c
    ST398:
    SAPIG1102
    T0131:
    SAT0131_01144
    TCH60:
    HMPREF0772_12127 (mntH)
    TW20:
    SATW20_11000
    USA300_TCH1516:
    VC40:
    SAVC_04681

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNKRHSTNEQLSLDEINNTIKFDHRSSNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGG
    N315            MNNKRHSTNEQLSLDEINNTIKFDHRSSNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGG
    NCTC8325        MNNKRHSTNEQLSLDEINNTIKFDHRSSNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGG
    Newman          MNNKRHSTNEQLSLDEINNTIKFDHRSSNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGG
    USA300_FPR3757  MNNKRHSTNEQLSLDEINNTIKFDHRSSNKQKFLSFLGPGLLVAVGYMDPGNWITSMQGG
                    ************************************************************

    COL             AQYGYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRPIAIIFWIIAELAI
    N315            AQYGYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRPIAIIFWIIAELAI
    NCTC8325        AQYGYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRPIAIIFWIIAELAI
    Newman          AQYGYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRPIAIIFWIIAELAI
    USA300_FPR3757  AQYGYTLLFVILISSLSAMLLQSMTVRLGIATGMDLAQMTRHYLSRPIAIIFWIIAELAI
                    ************************************************************

    COL             IATDIAEVIGSAIALNLLFNIPLIVGALITVLDVFLLLFIMKYGFRKIEAIVGTLIFTVL
    N315            IATDIAEVIGSAIALNLLFNIPLIVGALITVLDVFLLLFIMKYGFRKIEAIVGTLIFTVL
    NCTC8325        IATDIAEVIGSAIALNLLFNIPLIVGALITVLDVFLLLFIMKYGFRKIEAIVGTLIFTVL
    Newman          IATDIAEVIGSAIALNLLFNIPLIVGALITVLDVFLLLFIMKYGFRKIEAIVGTLIFTVL
    USA300_FPR3757  IATDIAEVIGSAIALNLLFNIPLIVGALITVLDVFLLLFIMKYGFRKIEAIVGTLIFTVL
                    ************************************************************

    COL             FIFIFEVYISSPQLNAVLNGFIPHSEIITNNGILYIALGIIGATIMPHNLYLHSSIVQSR
    N315            FIFIFEVYISSPQLNAVLNGFIPHSEIITNNGILYIALGIIGATIMPHNLYLHSSIVQSR
    NCTC8325        FIFIFEVYISSPQLNAVLNGFIPHSEIITNNGILYIALGIIGATIMPHNLYLHSSIVQSR
    Newman          FIFIFEVYISSPQLNAVLNGFIPHSEIITNNGILYIALGIIGATIMPHNLYLHSSIVQSR
    USA300_FPR3757  FIFIFEVYISSPQLNAVLNGFIPHSEIITNNGILYIALGIIGATIMPHNLYLHSSIVQSR
                    ************************************************************

    COL             TYSRHNNEEKAQAIKFATIDSNIQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHA
    N315            TYSRHNNEEKAQAIKFATIDSNIQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHA
    NCTC8325        TYSRHNNEEKAQAIKFATIDSNIQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHA
    Newman          TYSRHNNEEKAQAIKFATIDSNIQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHA
    USA300_FPR3757  TYSRHNNEEKAQAIKFATIDSNIQLSIAFVVNCLLLVLGASLFFNSNADDLGGFYDLYHA
                    ************************************************************

    COL             LKTEPVLGATMGAIMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
    N315            LKTEPVLGATMGAIMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
    NCTC8325        LKTEPVLGATMGAIMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
    Newman          LKTEPVLGATMGAIMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
    USA300_FPR3757  LKTEPVLGATMGAIMSTLFAVALLASGQNSTITGTLAGQIVMEGFLRLHIPNWLRRLITR
                    ************************************************************

    COL             SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGPFYNKT
    N315            SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGPFYNKT
    NCTC8325        SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGPFYNKT
    Newman          SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGPFYNKT
    USA300_FPR3757  SLAVIPVIVCLIIFKGNAAKIEQLLVFSQVFLSIALPFCLIPLQLATSNKDLMGPFYNKT
                    ************************************************************

    COL             WVNIISWTLIIILSILNVYLIVQTFQELQS
    N315            WVNIISWTLIIILSILNVYLIVQTFQELQS
    NCTC8325        WVNIISWTLIIILSILNVYLIVQTFQELQS
    Newman          WVNIISWTLIIILSILNVYLIVQTFQELQS
    USA300_FPR3757  WVNIISWTLIIILSILNVYLIVQTFQELQS
                    ******************************