From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003340000
  • symbol?:
  • description?: cell division protein FtsW

      descriptions from strain specific annotations:

    • cell division protein FtsW
    • cell cycle protein FtsW
    • cell division protein
    • cell cycle protein
    • cell cycle family protein
    • cell division membrane protein
    • cell division protein,FtsW/RodA/SpoVE family protein
    • FtsW/RodA/SpoVE family cell division protein
    • putative cell division protein
  • strand?: +
  • coordinates?: 3704859..3706097
  • synteny block?: BlockID0024240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1070 (ftsW)
    08BA02176:
    C248_1140
    11819-97:
    MS7_1070
    71193:
    ST398NM01_1110
    ECT-R 2:
    ECTR2_968
    ED133:
    SAOV_1055
    ED98:
    SAAV_1079
    HO 5096 0412:
    SAEMRSA15_09430
    JH1:
    SaurJH1_1195
    JH9:
    SaurJH9_1173
    JKD6008:
    SAA6008_01068 (ftsW)
    JKD6159:
    SAA6159_00968 (ftsW)
    LGA251:
    SARLGA251_10260
    M013:
    M013TW_1045
    MRSA252:
    SAR1087
    MSHR1132:
    SAMSHR1132_09600
    MSSA476:
    SAS1048
    Mu3:
    SAHV_1105
    Mu50:
    SAV1113
    MW2:
    MW0996
    RF122:
    SAB0978
    ST398:
    SAPIG1110
    T0131:
    SAT0131_01152 (lacC)
    TCH60:
    HMPREF0772_12119
    TW20:
    SATW20_11080
    USA300_TCH1516:
    USA300HOU_1051
    VC40:
    SAVC_04730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNFRSILRYIGKTSKFIDYPLLVTYIVLSLIGLVMVYSASMVPATKGTLTGGIDVPGTY
    N315            -----------------------------------MVYSASMVPATKGTLTGGIDVPGTY
    NCTC8325        MKNFRSILRYIGKTSKFIDYPLLVTYIVLSLIGLVMVYSASMVPATKGTLTGGIDVPGTY
    Newman          MKNFRSILRYIGKTSKFIDYPLLVTYIVLSLIGLVMVYSASMVPATKGTLTGGIDVPGTY
    USA300_FPR3757  MKNFRSILRYIGKTSKFIDYPLLVTYIVLSLIGLVMVYSASMVPATKGTLTGGIDVPGTY
                                                       *************************

    COL             FYNRQLAYVIMSFIIVFFIAFLMNVKLLSNIKVQKGMIITIVSLLLLTLVIGKDINGSKS
    N315            FYNRQLAYVIMSFIIVFFIAFLMNVKLLSNIKVQKGMIITIVSLLLLTLVIGKDINGSKS
    NCTC8325        FYNRQLAYVIMSFIIVFFIAFLMNVKLLSNIKVQKGMIITIVSLLLLTLVIGKDINGSKS
    Newman          FYNRQLAYVIMSFIIVFFIAFLMNVKLLSNIKVQKGMIITIVSLLLLTLVIGKDINGSKS
    USA300_FPR3757  FYNRQLAYVIMSFIIVFFIAFLMNVKLLSNIKVQKGMIITIVSLLLLTLVIGKDINGSKS
                    ************************************************************

    COL             WINLGFMNLQASELLKIAIILYIPFMISKKMPRVLSKPKLILSPIVLALGCTFLVFLQKD
    N315            WINLGFMNLQASELLKIAIILYIPFMISKKMPRVLSKPKLILSPIVLALGCTFLVFLQKD
    NCTC8325        WINLGFMNLQASELLKIAIILYIPFMISKKMPRVLSKPKLILSPIVLALGCTFLVFLQKD
    Newman          WINLGFMNLQASELLKIAIILYIPFMISKKMPRVLSKPKLILSPIVLALGCTFLVFLQKD
    USA300_FPR3757  WINLGFMNLQASELLKIAIILYIPFMISKKMPRVLSKPKLILSPIVLALGCTFLVFLQKD
                    ************************************************************

    COL             VGQTLLILIILVAIIFYSGIGVNKVLRFGIPAVLGFLVVFVIALMAGWLPSYLTARFSTL
    N315            VGQTLLILIILVAIIFYSGIGVNKVLRFGIPAVLGFLVVFVIALMAGWLPSYLTARFSTL
    NCTC8325        VGQTLLILIILVAIIFYSGIGVNKVLRFGIPAVLGFLVVFVIALMAGWLPSYLTARFSTL
    Newman          VGQTLLILIILVAIIFYSGIGVNKVLRFGIPAVLGFLVVFVIALMAGWLPSYLTARFSTL
    USA300_FPR3757  VGQTLLILIILVAIIFYSGIGVNKVLRFGIPAVLGFLVVFVIALMAGWLPSYLTARFSTL
                    ************************************************************

    COL             TDPFQFESGTGYHISNSLLAIGNGGVFGKGLGNSAMKLGYLPEPHTDFIFAIICEELGLI
    N315            TDPFQFESGTGYHISNSLLAIGNGGVFGKGLGNSAMKLGYLPEPHTDFIFAIICEELGLI
    NCTC8325        TDPFQFESGTGYHISNSLLAIGNGGVFGKGLGNSAMKLGYLPEPHTDFIFAIICEELGLI
    Newman          TDPFQFESGTGYHISNSLLAIGNGGVFGKGLGNSAMKLGYLPEPHTDFIFAIICEELGLI
    USA300_FPR3757  TDPFQFESGTGYHISNSLLAIGNGGVFGKGLGNSAMKLGYLPEPHTDFIFAIICEELGLI
                    ************************************************************

    COL             GGLLVITLEFFIVYRAFQFANKTSSYFYKLVCVGIATYFGSQTFVNIGGISATIPLTGVP
    N315            GGLLVITLEFFIVYRAFQFANKTSSYFYKLVCVGIATYFGSQTFVNIGGISATIPLTGVP
    NCTC8325        GGLLVITLEFFIVYRAFQFANKTSSYFYKLVCVGIATYFGSQTFVNIGGISATIPLTGVP
    Newman          GGLLVITLEFFIVYRAFQFANKTSSYFYKLVCVGIATYFGSQTFVNIGGISATIPLTGVP
    USA300_FPR3757  GGLLVITLEFFIVYRAFQFANKTSSYFYKLVCVGIATYFGSQTFVNIGGISATIPLTGVP
                    ************************************************************

    COL             LPFISFGGSSMISLSIAMGLLLIVGKQIKVDQQRKKQQQKVDIRRQFN
    N315            LPFISFGGSSMISLSIAMGLLLIVGKQIKVDQQRKKQQQKVDIRRQFN
    NCTC8325        LPFISFGGSSMISLSIAMGLLLIVGKQIKVDQQRKKQQQKVDIRRQFN
    Newman          LPFISFGGSSMISLSIAMGLLLIVGKQIKVDQQRKKQQQKVDIRRQFN
    USA300_FPR3757  LPFISFGGSSMISLSIAMGLLLIVGKQIKVDQQRKKQQQKVDIRRQFN
                    ************************************************