From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003363000
  • symbol?: isdE
  • description?: iron transport lipoprotein SirF

      descriptions from strain specific annotations:

    • iron transport lipoprotein SirF
    • iron compound ABC transporter iron compound-binding protein
    • periplasmic binding protein
    • iron (Fe+3) ABC transporter binding protein
    • heme ABC transporter, heme-binding protein IsdE
    • Heme transporter IsdDEF, lipoprotein IsdE
    • putative iron compound ABC transporter iron compound-binding protein
    • putative transport system extracellular bindinglipoprotein
    • periplasmic binding family protein
    • High-affinity heme uptake system protein isdE
    • iron (Fe+3) ABC superfamily ATP binding cassette transporter, binding protein
  • strand?: +
  • coordinates?: 3729035..3729913
  • synteny block?: BlockID0024460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0980 (isdE)
    NCTC8325:
    Newman:
    NWMN_1044 (isdE)
    USA300_FPR3757:
    04-02981:
    SA2981_1089 (isdE)
    08BA02176:
    C248_1159 (isdE)
    11819-97:
    MS7_1089 (isdE)
    71193:
    ST398NM01_1129
    ECT-R 2:
    ECTR2_987
    ED133:
    SAOV_1129 (isdE)
    ED98:
    SAAV_1099 (isdE)
    HO 5096 0412:
    SAEMRSA15_09620 (isdE)
    JH1:
    SaurJH1_1214
    JH9:
    SaurJH9_1192
    JKD6008:
    SAA6008_01087 (isdE)
    JKD6159:
    SAA6159_00987 (isdE)
    LGA251:
    SARLGA251_10450 (isdE)
    M013:
    M013TW_1066
    MRSA252:
    SAR1106 (isdE)
    MSHR1132:
    SAMSHR1132_09790
    MSSA476:
    SAS1067
    Mu3:
    SAHV_1124
    Mu50:
    SAV1133
    MW2:
    MW1015 (isdE)
    RF122:
    SAB0997 (isdE)
    ST398:
    SAPIG1129
    T0131:
    SAT0131_01172
    TCH60:
    HMPREF0772_12100 (isdE)
    TW20:
    SATW20_11270 (isdE)
    USA300_TCH1516:
    USA300HOU_1067 (isdE)
    VC40:
    SAVC_04825

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRIIKYLTILVISVVILTSCQSSSSQESTKSGEFRIVPTTVALTMTLDKLDLPIVGKPTS
    N315            MRIIKYLTILVISVVILTSCQSSSSQESTKSGEFRIVPTTVALTMTLDKLDLPIVGKPTS
    NCTC8325        ----------MISVVILTSCQSSSSQESTKSGEFRIVPTTVALTMTLDKLDLPIVGKPTS
    Newman          MRIIKYLTILVISVVILTSCQSSSSQESTKSGEFRIVPTTVALTMTLDKLDLPIVGKPTS
    USA300_FPR3757  ----------MISVVILTSCQSSSSQESTKSGEFRIVPTTVALTMTLDKLDLPIVGKPTS
                              :*************************************************

    COL             YKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFD
    N315            YKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFD
    NCTC8325        YKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFD
    Newman          YKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFD
    USA300_FPR3757  YKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFD
                    ************************************************************

    COL             SLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYL
    N315            SLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYL
    NCTC8325        SLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYL
    Newman          SLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYL
    USA300_FPR3757  SLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYL
                    ************************************************************

    COL             VATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQ
    N315            VATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQ
    NCTC8325        VATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQ
    Newman          VATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQ
    USA300_FPR3757  VATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQ
                    ************************************************************

    COL             KEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYKDKK
    N315            KEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYKDKK
    NCTC8325        KEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYKDKK
    Newman          KEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYKDKK
    USA300_FPR3757  KEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYKDKK
                    ****************************************************