From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003367000
  • symbol?: srtB
  • description?: NPQTN specific sortase B

      descriptions from strain specific annotations:

    • NPQTN specific sortase B
    • peptidase C60B, sortase B
    • peptidase C60B sortase B
    • sortase B transpeptidase
    • sortase, SrtB family
    • Sortase B family protein
    • SrtB family sortase
  • strand?: +
  • coordinates?: 3731763..3732497
  • synteny block?: BlockID0024500
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1145 (srtB)
    N315:
    SA0982 (srtB)
    NCTC8325:
    Newman:
    NWMN_1046 (srtB)
    USA300_FPR3757:
    04-02981:
    SA2981_1091 (srtB)
    08BA02176:
    C248_1161 (srtB)
    11819-97:
    MS7_1091 (srtB)
    71193:
    ST398NM01_1131
    ECT-R 2:
    ECTR2_989 (srtB)
    ED133:
    SAOV_1131 (srtB)
    ED98:
    SAAV_1101 (srtB)
    HO 5096 0412:
    SAEMRSA15_09640 (srtB)
    JH1:
    SaurJH1_1216
    JH9:
    SaurJH9_1194
    JKD6008:
    SAA6008_01089 (srtB)
    JKD6159:
    SAA6159_00989 (srtB)
    LGA251:
    SARLGA251_10470 (srtB)
    M013:
    M013TW_1068
    MRSA252:
    SAR1108 (srtB)
    MSHR1132:
    SAMSHR1132_09810
    MSSA476:
    SAS1069
    Mu3:
    SAHV_1126
    Mu50:
    SAV1135
    MW2:
    MW1017 (srtB)
    RF122:
    SAB0999 (srtB)
    ST398:
    SAPIG1131 (srtB)
    T0131:
    SAT0131_01175 (budB)
    TCH60:
    HMPREF0772_12098 (srtB)
    TW20:
    SATW20_11290 (srtB)
    USA300_TCH1516:
    VC40:
    SAVC_04840

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRMKRFLTIVQILLVVIIIIFGYKIVQTYIEDKQERANYEKLQQKFQMLMSKHQEHVRPQ
    N315            MRMKRFLTIVQILLVVIIIIFGYKIVQTYIEDKQERANYEKLQQKFQMLMSKHQEHVRPQ
    NCTC8325        MRMKRFLTIVQILLVVIIIIFGYKIVQTYIEDKQERANYEKLQQKFQMLMSKHQEHVRPQ
    Newman          MRMKRFLTIVQILLVVIIIIFGYKIVQTYIEDKQERANYEKLQQKFQMLMSKHQEHVRPQ
    USA300_FPR3757  MRMKRFLTIVQILLVVIIIIFGYKIVQTYIEDKQERANYEKLQQKFQMLMSKHQEHVRPQ
                    ************************************************************

    COL             FESLEKINKDIVGWIKLSGTSLNYPVLQGKTNHDYLNLDFEREHRRKGSIFMDFRNELKN
    N315            FESLEKINKDIVGWIKLSGTSLNYPVLQGKTNHDYLNLDFEREHRRKGSIFMDFRNELKN
    NCTC8325        FESLEKINKDIVGWIKLSGTSLNYPVLQGKTNHDYLNLDFEREHRRKGSIFMDFRNELKN
    Newman          FESLEKINKDIVGWIKLSGTSLNYPVLQGKTNHDYLNLDFEREHRRKGSIFMDFRNELKN
    USA300_FPR3757  FESLEKINKDIVGWIKLSGTSLNYPVLQGKTNHDYLNLDFEREHRRKGSIFMDFRNELKN
                    ************************************************************

    COL             LNHNTILYGHHVGDNTMFDVLEDYLKQSFYEKHKIIEFDNKYGKYQLQVFSAYKTTTKDN
    N315            LNHNTILYGHHVGDNTMFDVLEDYLKQSFYEKHKIIEFDNKYGKYQLQVFSAYKTTTKDN
    NCTC8325        LNHNTILYGHHVGDNTMFDVLEDYLKQSFYEKHKIIEFDNKYGKYQLQVFSAYKTTTKDN
    Newman          LNHNTILYGHHVGDNTMFDVLEDYLKQSFYEKHKIIEFDNKYGKYQLQVFSAYKTTTKDN
    USA300_FPR3757  LNHNTILYGHHVGDNTMFDVLEDYLKQSFYEKHKIIEFDNKYGKYQLQVFSAYKTTTKDN
                    ************************************************************

    COL             YIRTDFENDQDYQQFLDETKRKSVINSDVNVTVKDRIMTLSTCEDAYSETTKRIVVVAKI
    N315            YIRTDFENDQDYQQFLDETKRKSVINSDVNVTVKDKIMTLSTCEDAYSETTKRIVVVAKI
    NCTC8325        YIRTDFENDQDYQQFLDETKRKSVINSDVNVTVKDRIMTLSTCEDAYSETTKRIVVVAKI
    Newman          YIRTDFENDQDYQQFLDETKRKSVINSDVNVTVKDRIMTLSTCEDAYSETTKRIVVVAKI
    USA300_FPR3757  YIRTDFENDQDYQQFLDETKRKSVINSDVNVTVKDRIMTLSTCEDAYSETTKRIVVVAKI
                    ***********************************:************************

    COL             IKVS
    N315            IKVS
    NCTC8325        IKVS
    Newman          IKVS
    USA300_FPR3757  IKVS
                    ****