From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003372000
  • symbol?:
  • description?: rRNA methylase

      descriptions from strain specific annotations:

    • rRNA methylase
    • RNA methyltransferase
    • tRNA/rRNA methyltransferase SpoU
    • SpoU rRNA methylase family protein
    • TrmH family rRNA methyltransferase
    • RNA 2'-O ribose methyltransferase substrate binding family protein
    • TrmH family RNA methyltransferase
    • 23S rRNA methyltransferase
  • strand?: +
  • coordinates?: 3734561..3735301
  • synteny block?: BlockID0024550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1093 (spoU)
    08BA02176:
    C248_1164
    11819-97:
    MS7_1093
    71193:
    ST398NM01_1133
    ECT-R 2:
    ECTR2_991
    ED133:
    SAOV_1133
    ED98:
    SAAV_1103
    HO 5096 0412:
    SAEMRSA15_09670
    JH1:
    SaurJH1_1218
    JH9:
    SaurJH9_1196
    JKD6008:
    SAA6008_01091 (spoU)
    JKD6159:
    SAA6159_00991 (spoU/trmH)
    LGA251:
    SARLGA251_10490
    M013:
    M013TW_1070
    MRSA252:
    SAR1110
    MSHR1132:
    SAMSHR1132_09830
    MSSA476:
    SAS1071
    Mu3:
    SAHV_1128
    Mu50:
    SAV1137
    MW2:
    MW1020
    RF122:
    SAB1001
    ST398:
    SAPIG1133
    T0131:
    SAT0131_01178
    TCH60:
    HMPREF0772_12096
    TW20:
    SATW20_11310
    USA300_TCH1516:
    USA300HOU_1072 (spoU/trmH)
    VC40:
    SAVC_04850

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEQITSAQNNRIKQANKLKKKRERDKTGLALIEGVHLIEEAYQSGIVITQLFAIEPARLD
    N315            MEQITSAQNNRIKQANKLKKKRERDKTGLALIEGVHLIEEAYQSGIVITQLFAIEPARLD
    NCTC8325        MEQITSAQNNRIKQANKLKKKRERDKTGLALIEGVHLIEEAYQSGIVITQLFAIEPARLD
    Newman          MEQITSAQNNRIKQANKLKKKRERDKTGLALIEGVHLIEEAYQSGIVITQLFAIEPARLD
    USA300_FPR3757  MEQITSAQNNRIKQANKLKKKRERDKTGLALIEGVHLIEEAYQSGIVITQLFAIEPARLD
                    ************************************************************

    COL             QQIIAYAQEVFEINMKVAESLSGTVTPQGFFAIIEKPHYDISKAQQVLLIDRVQDPGNLG
    N315            QQIIAYAQEVFEINMKVAESLSGTVTPQGFFAIIEKPHYDISKAQQVLLIDRVQDPGNLG
    NCTC8325        QQIIAYAQEVFEINMKVAESLSGTVTPQGFFAIIEKPHYDISKAQQVLLIDRVQDPGNLG
    Newman          QQIIAYAQEVFEINMKVAESLSGTVTPQGFFAIIEKPHYDISKAQQVLLIDRVQDPGNLG
    USA300_FPR3757  QQIIAYAQEVFEINMKVAESLSGTVTPQGFFAIIEKPHYDISKAQQVLLIDRVQDPGNLG
                    ************************************************************

    COL             TLIRTADAAGMDAVIMEKGTTDPYQDKVLRASQGSVFHLPVMTQDLDTFITQFNGPVYGT
    N315            TLIRTADAAGMDAVIMEKGTTDPYQDKVLRASQGSVFHLPVMTQDLDTFITQFNGPVYGT
    NCTC8325        TLIRTADAAGMDAVIMEKGTTDPYQDKVLRASQGSVFHLPVMTQDLDTFITQFNGPVYGT
    Newman          TLIRTADAAGMDAVIMEKGTTDPYQDKVLRASQGSVFHLPVMTQDLDTFITQFNGPVYGT
    USA300_FPR3757  TLIRTADAAGMDAVIMEKGTTDPYQDKVLRASQGSVFHLPVMTQDLDTFITQFNGPVYGT
                    ************************************************************

    COL             ALENAVAYKEVTSSDSFALLLGNEGEGVNPELLAHTTQNLIIPIYGKAESLNVAIAGSIL
    N315            ALENAVAYKEVTSSDSFALLLGNEGEGVNPELLAHTTQNLIIPIYGKAESLNVAIAGSIL
    NCTC8325        ALENAVAYKEVTSSDSFALLLGNEGEGVNPELLAHTTQNLIIPIYGKAESLNVAIAGSIL
    Newman          ALENAVAYKEVTSSDSFALLLGNEGEGVNPELLAHTTQNLIIPIYGKAESLNVAIAGSIL
    USA300_FPR3757  ALENAVAYKEVTSSDSFALLLGNEGEGVNPELLAHTTQNLIIPIYGKAESLNVAIAGSIL
                    ************************************************************

    COL             LYHLKG
    N315            LYHLKG
    NCTC8325        LYHLKG
    Newman          LYHLKG
    USA300_FPR3757  LYHLKG
                    ******