From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003388000
  • symbol?: sdhA
  • description?: succinate dehydrogenase flavoprotein subunit

      descriptions from strain specific annotations:

    • succinate dehydrogenase flavoprotein subunit
    • succinate dehydrogenase/fumarate reductase, flavoprotein subunit
    • putative succinate dehydrogenase flavoprotein subunit
    • Succinate dehydrogenase subunit A
  • strand?: +
  • coordinates?: 3749933..3751699
  • synteny block?: BlockID0024710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1159 (sdhA)
    N315:
    SA0995 (sdhA)
    NCTC8325:
    Newman:
    NWMN_1061 (sdhA)
    USA300_FPR3757:
    04-02981:
    SA2981_1104 (sdhA)
    08BA02176:
    C248_1177 (sdhA)
    11819-97:
    MS7_1105 (sdhA)
    71193:
    ST398NM01_1144
    ECT-R 2:
    ECTR2_1002 (sdhA)
    ED133:
    SAOV_1145
    ED98:
    SAAV_1116 (sdhA)
    HO 5096 0412:
    SAEMRSA15_09780 (sdhA)
    JH1:
    SaurJH1_1229 (sdhA)
    JH9:
    SaurJH9_1207 (sdhA)
    JKD6008:
    SAA6008_01102 (sdhA)
    JKD6159:
    SAA6159_01002 (sdhA)
    LGA251:
    SARLGA251_10600 (sdhA)
    M013:
    M013TW_1081
    MRSA252:
    SAR1121 (sdhA)
    MSHR1132:
    SAMSHR1132_09940
    MSSA476:
    SAS1082 (sdhA)
    Mu3:
    SAHV_1139 (sdhA)
    Mu50:
    SAV1148 (sdhA)
    MW2:
    MW1031 (sdhA)
    RF122:
    SAB1012 (sdhA)
    ST398:
    SAPIG1144
    T0131:
    SAT0131_01191 (rplQ)
    TCH60:
    HMPREF0772_12085 (sdhA)
    TW20:
    SATW20_11420 (sdhA)
    USA300_TCH1516:
    USA300HOU_1084 (sdhA)
    VC40:
    SAVC_04905 (sdhA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
    N315            MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
    NCTC8325        MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
    Newman          MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
    USA300_FPR3757  MAEKHLIVVGGGLAGLMSTIKAAEKGAHVDLFSVVPVKRSHSVCAQGGINGAVNTKGEGD
                    ************************************************************

    COL             SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
    N315            SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
    NCTC8325        SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
    Newman          SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
    USA300_FPR3757  SPWIHFDDTVYGGDFLANQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
                    ************************************************************

    COL             HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
    N315            HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
    NCTC8325        HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
    Newman          HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
    USA300_FPR3757  HHRTAYAGATTGQQLLYALDEQVRAYEVDGLVTKYEGWEFLGIVKGDDDSARGIVAQNMT
                    ************************************************************

    COL             TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
    N315            TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
    NCTC8325        TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
    Newman          TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
    USA300_FPR3757  TAEIETFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAIYANGEFIQIHPTAI
                    ************************************************************

    COL             PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
    N315            PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
    NCTC8325        PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
    Newman          PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
    USA300_FPR3757  PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
                    ************************************************************

    COL             LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
    N315            LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
    NCTC8325        LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
    Newman          LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
    USA300_FPR3757  LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
                    ************************************************************

    COL             DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDM
    N315            DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDM
    NCTC8325        DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDM
    Newman          DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDM
    USA300_FPR3757  DYDQMTNIKGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAIDYISNIDRSYTDM
                    ************************************************************

    COL             DESIFEKRKAEEQERFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
    N315            DESIFEKRKAEEQERFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
    NCTC8325        DESIFEKRKAEEQERFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
    Newman          DESIFEKRKAEEQERFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
    USA300_FPR3757  DESIFEKRKAEEQERFDKLLAMRGTENAYKLHRELGEIMTANVTVVRENEKLLETDKKIV
                    ************************************************************

    COL             ELMKRYEDIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
    N315            ELMKRYEDIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
    NCTC8325        ELMKRYEDIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
    Newman          ELMKRYEDIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
    USA300_FPR3757  ELMKRYEDIDMEDTQTWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
                    ************************************************************

    COL             NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
    N315            NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
    NCTC8325        NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
    Newman          NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
    USA300_FPR3757  NDEEWLKTTMASFQGAFEKPQFTYDDVDVSLIPPRKRDYTSKSKGGKK
                    ************************************************