From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003402000
  • symbol?: efb
  • description?: fibrinogen-binding protein

      descriptions from strain specific annotations:

    • fibrinogen-binding protein
    • extracellular fibrinogen-binding protein
    • Extracellular fibrinogen-binding protein Efb
    • fibrinogen-binding protein precursor
    • pseudogene
  • strand?: +
  • coordinates?: 3757926..3760626
  • synteny block?: BlockID0024850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1168 (efb)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1114
    08BA02176:
    C248_1186 (fib)
    11819-97:
    MS7_1114
    71193:
    ST398NM01_1154
    ECT-R 2:
    ECTR2_1012
    ED133:
    SAOV_1155
    ED98:
    SAAV_1126 (efb)
    HO 5096 0412:
    SAEMRSA15_09870b (fib)
    JH1:
    SaurJH1_1239
    JH9:
    SaurJH9_1215
    JKD6008:
    SAA6008_01111 (efb)
    JKD6159:
    SAA6159_01010 (efb)
    LGA251:
    SARLGA251_10680 (fib)
    M013:
    M013TW_1090
    MRSA252:
    SAR1130 (fib)
    MSHR1132:
    SAMSHR1132_10020
    MSSA476:
    SAS1091
    Mu3:
    SAHV_1148
    Mu50:
    SAV1158
    MW2:
    MW1040
    RF122:
    SAB1021 (fib)
    ST398:
    SAPIG1154
    T0131:
    SAT0131_01201 (rplO)
    TCH60:
    HMPREF0772_12076 (efb)
    TW20:
    SATW20_11500 (fib)
    USA300_TCH1516:
    USA300HOU_1094
    VC40:
    SAVC_04945

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNKLIAKSLLTLAAIGITTTTIASTADASEGYGPREKKPVSINHNIVEYNDGTFKYQSR
    N315            MKNKLIAKSLLTIAAIGITTTTIASTADASEGYGPREKKPVSINHNIVEYNDGTFKYQSR
    NCTC8325        MKNKLIAKSLLTLAAIGITTTTIASTADASEGYGPREKKPVSINHNIVEYNDGTFKYQSR
    Newman          MKNKLIAKSLLTLAAIGITTTTIASTADASEGYGPREKKPVSINHNIVEYNDGTFKYQSR
    USA300_FPR3757  MKNKLIAKSLLTLAAIGITTTTIASTADASEGYGPREKKPVSINHNIVEYNDGTFKYQSR
                    ************:***********************************************

    COL             PKFNSTPKYIKFKHDYNILEFNDGTFEYGARPQFNKPAAKTDATIKKEQKLIQAQNLVRE
    N315            PKFNSTPKYIKFKHDYNILEFNDGTFEYGARPQFNKPAAKTDATIKKEQKLIQAQNLVRE
    NCTC8325        PKFNSTPKYIKFKHDYNILEFNDGTFEYGARPQFNKPAAKTDATIKKEQKLIQAQNLVRE
    Newman          PKFNSTPKYIKFKHDYNILEFNDGTFEYGARPQFNKPAAKTDATIKKEQKLIQAQNLVRE
    USA300_FPR3757  PKFNSTPKYIKFKHDYNILEFNDGTFEYGARPQFNKPAAKTDATIKKEQKLIQAQNLVRE
                    ************************************************************

    COL             FEKTHTVSAHRKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVK
    N315            FEKTHTVSAHRKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVR
    NCTC8325        FEKTHTVSAHRKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVK
    Newman          FEKTHTVSAHRKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVK
    USA300_FPR3757  FEKTHTVSAHRKAQKAVNLVSFEYKVKKMVLQERIDNVLKQGLVK
                    ********************************************: