From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003431000
  • symbol?:
  • description?: YfcC family protein

      descriptions from strain specific annotations:

    • YfcC family protein
    • TRAP family protein
    • APC family amino acid-polyamine-organocation transporter, antiporter
    • arginine/ornithine antiporter
    • Arginine/ornithine antiporter ArcD
    • arginine/ornithine APC transporter
    • C4-dicarboxylate anaerobic carrier
    • C4-dicarboxylate anaerobic carrier DcuC
    • citrate transporter family protein
    • dctM-like transporters family protein
    • membrane protein
  • strand?: +
  • coordinates?: 3782855..3783681
  • synteny block?: BlockID0025120
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1127 (arcD)
    08BA02176:
    C248_1197
    11819-97:
    MS7_1126
    71193:
    ST398NM01_1165
    ECT-R 2:
    ECTR2_1025
    ED133:
    SAOV_1169
    ED98:
    SAAV_1139
    HO 5096 0412:
    SAEMRSA15_10020
    JH1:
    SaurJH1_1254
    JH9:
    SaurJH9_1229
    JKD6008:
    SAA6008_01123
    JKD6159:
    SAA6159_01021
    LGA251:
    SARLGA251_10800
    M013:
    M013TW_1102
    MRSA252:
    SAR1144
    MSHR1132:
    SAMSHR1132_10120
    MSSA476:
    SAS1104
    Mu3:
    SAHV_1161
    Mu50:
    SAV1171
    MW2:
    MW1052
    RF122:
    SAB1035
    ST398:
    SAPIG1165
    T0131:
    SAT0131_01215
    TCH60:
    HMPREF0772_12063
    TW20:
    SATW20_11630
    USA300_TCH1516:
    USA300HOU_1108 (arcD2)
    VC40:
    SAVC_05005

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MENTINESEKKKRFKLKMPGAFMILFILTVVAVIATWVIPAGAYSKLSYEPSSQELKIVN
    N315            MENTINESEKKKRFKLKMPGAFMILFILTVVAVIATWVIPAGAYSKLSYEPSSQELKIVN
    NCTC8325        ----------------------MILFILTVVAVIATWVIPAGAYSKLSYEPSSQELKIVN
    Newman          MENTINESEKKKRFKLKMPGAFMILFILTVVAVIATWVIPAGAYSKLSYEPSSQELKIVN
    USA300_FPR3757  MENTINESEKKKRFKLKMPGAFMILFILTVVAVIATWVIPAGAYSKLSYEPSSQELKIVN
                                          **************************************

    COL             PHNQVKKVPGTQQELDKMGVKIKIEQFKSGAINKPVSIPNTYERLKQHPAGPEQITSSMV
    N315            PHNQVKKVPGTQQELDKMGVKIKIEQFKSGAINKPVSIPNTYERLKQHPAGPEQITSSMV
    NCTC8325        PHNQVKKVPGTQQELDKMGVKIKIEQFKSGAINKPVSIPNTYERLKQHPAGPEQITSSMV
    Newman          PHNQVKKVPGTQQELDKMGVKIKIEQFKSGAINKPVSIPNTYERLKQHPAGPEQITSSMV
    USA300_FPR3757  PHNQVKKVPGTQQELDKMGVKIKIEQFKSGAINKPVSIPNTYERLKQHPAGPEQITSSMV
                    ************************************************************

    COL             EGTIEAVDIMVFILVLGGLIGVVQASGSFESGLLALTKKTKGHEFMLIVFVSILMIIGGT
    N315            EGTIEAVDIMVFILVLGGLIGVVQASGSFESGLLALTKKTKGHEFMLIVFVSILMIIGGT
    NCTC8325        EGTIEAVDIMVFILVLGGLIGVVQASGSFESGLLALTKKTKGHEFMLIVFVSILMIIGGT
    Newman          EGTIEAVDIMVFILVLGGLIGVVQASGSFESGLLALTKKTKGHEFMLIVFVSILMIIGGT
    USA300_FPR3757  EGTIEAVDIMVFILVLGGLIGVVQASGSFESGLLALTKKTKGHEFMLIVFVSILMIIGGT
                    ************************************************************

    COL             LCGIEEEAVAFYPILVPIFIALGYDSIVSVGAIFLASSVGSTFSTINPFSVVIASNAAGT
    N315            LCGIEEEAVAFYPILVPIFIALGYDSIVSVGAIFLASSVGSTFSTINPFSVVIASNAAGT
    NCTC8325        LCGIEEEAVAFYPILVPIFIALGYDSIVSVGAIFLASSVGSTFSTINPFSVVIASNAAGT
    Newman          LCGIEEEAVAFYPILVPIFIALGYDSIVSVGAIFLASSVGSTFSTINPFSVVIASNAAGT
    USA300_FPR3757  LCGIEEEAVAFYPILVPIFIALGYDSIVSVGAIFLASSVGSTFSTINPFSVVIASNAAGT
                    ************************************************************

    COL             TFTDGLYWRIGACIVGAIFVISYLYWYCKKIKNDPKASYSYEDKDAFEQQWSVLKDDDSA
    N315            TFTDGLYWRIGACIVGAIFVISYLYWYCKTIKNDPKASYSYEDKDAFEQQWSVLKDDDSA
    NCTC8325        TFTDGLYWRIGACIVGAIFVISYLYWYCKKIKNDPKASYSYEDKDAFEQQWSVLKDDDSA
    Newman          TFTDGLYWRIGACIVGAIFVISYLYWYCKKIKNDPKASYSYEDKDAFEQQWSVLKDDDSA
    USA300_FPR3757  TFTDGLYWRIGACIVGAIFVISYLYWYCKKIKNDPKASYSYEDKDAFEQQWSVLKDDDSA
                    *****************************.******************************

    COL             HFTLRKKIILTLFVLPFPIMVWGVMTQGWWFPVMASAFLIFTIIIMFIAGTGKSGLGEKG
    N315            HFTLRKKIILTLFVLPFPIMVWGVMTQGWWFPVMASAFLIFTIIIMFIAGTGKSGLGEKG
    NCTC8325        HFTLRKKIILTLFVLPFPIMVWGVMTQGWWFPVMASAFLIFTIIIMFIAGTGKSGLGEKG
    Newman          HFTLRKKIILTLFVLPFPIMVWGVMTQGWWFPVMASAFLIFTIIIMFIAGTGKSGLGEKG
    USA300_FPR3757  HFTLRKKIILTLFVLPFPIMVWGVMTQGWWFPVMASAFLIFTIIIMFIAGTGKSGLGEKG
                    ************************************************************

    COL             TVDAFVNGASSLVGVSLIIGLARGINLVLNEGMISDTILHFSSSLVQHMSGPLFIIVLLF
    N315            TVDAFVNGASSLVGVSLIIGLARGINLVLNEGMISDTILHFSSSLVQHMSGPLFIIVLLF
    NCTC8325        TVDAFVNGASSLVGVSLIIGLARGINLVLNEGMISDTILHFSSSLVQHMSGPLFIIVLLF
    Newman          TVDAFVNGASSLVGVSLIIGLARGINLVLNEGMISDTILHFSSSLVQHMSGPLFIIVLLF
    USA300_FPR3757  TVDAFVNGASSLVGVSLIIGLARGINLVLNEGMISDTILHFSSSLVQHMSGPLFIIVLLF
                    ************************************************************

    COL             IFFCLGFIVPSSSGLAVLSMPIFAPLADTVGIPRFVIVTTYQFGQYAMLFLAPTGLVMAT
    N315            IFFCLGFIVPSSSGLAVLSMPIFAPLADTVGIPRFVIVTTYQFGQYAMLFLAPTGLVMAT
    NCTC8325        IFFCLGFIVPSSSGLAVLSMPIFAPLADTVGIPRFVIVTTYQFGQYAMLFLAPTGLVMAT
    Newman          IFFCLGFIVPSSSGLAVLSMPIFAPLADTVGIPRFVIVTTYQFGQYAMLFLAPTGLVMAT
    USA300_FPR3757  IFFCLGFIVPSSSGLAVLSMPIFAPLADTVGIPRFVIVTTYQFGQYAMLFLAPTGLVMAT
                    ************************************************************

    COL             LQMLNMRYSHWFRFVWPVVAFVLIFGGGVLITQVLIYS
    N315            LQMLNMRYSHWFRFVWPVVAFVLIFGGGVLITQVLIYS
    NCTC8325        LQMLNMRYSHWFRFVWPVVAFVLIFGGGVLITQVLIYS
    Newman          LQMLNMRYSHWFRFVWPVVAFVLIFGGGVLITQVLIYS
    USA300_FPR3757  LQMLNMRYSHWFRFVWPVVAFVLIFGGGVLITQVLIYS
                    **************************************