From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003435000
  • symbol?: eta
  • description?: permease

      descriptions from strain specific annotations:

    • permease
    • exfoliative toxin A
    • exfoliative toxin
    • C4-dicarboxylate transporter/malic acid transport family protein
    • C4-dicarboxylate transporter/malic acid transport protein
    • exfoliative toxin, putative
    • exfoliative toxin A/B
    • putative permease
    • TDT family tellurite/dicarboxylate transporter
  • strand?: -
  • coordinates?: 3785319..3786267
  • synteny block?: BlockID0025160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1082 (eta)
    USA300_FPR3757:
    04-02981:
    SA2981_1129
    08BA02176:
    C248_1199
    11819-97:
    MS7_1128
    71193:
    ST398NM01_1167
    ECT-R 2:
    ECTR2_1027
    ED133:
    SAOV_1171c
    ED98:
    SAAV_1141
    HO 5096 0412:
    SAEMRSA15_10040
    JH1:
    SaurJH1_1256
    JH9:
    SaurJH9_1231
    JKD6008:
    SAA6008_01125 (eta)
    JKD6159:
    SAA6159_01023 (eta)
    LGA251:
    SARLGA251_10820
    M013:
    M013TW_1104
    MRSA252:
    SAR1147
    MSHR1132:
    SAMSHR1132_10140
    MSSA476:
    SAS1106
    Mu3:
    SAHV_1163
    Mu50:
    SAV1173
    MW2:
    MW1054
    RF122:
    SAB1037c
    ST398:
    SAPIG1167
    T0131:
    SAT0131_01217
    TCH60:
    HMPREF0772_12060
    TW20:
    SATW20_11650
    USA300_TCH1516:
    USA300HOU_1110
    VC40:
    SAVC_05015

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRLQKAPLVTSGLVLGLLGLGNLLKDLSLTLNAVCGIFAFLIWIHLLCTMIKYFNNVKEQ
    N315            MRLQKAPLVTSGLVLGLLGLGNLLKDLSLTLNAVCGIFAFLIWIHLLCTMIKYFNNVKEQ
    NCTC8325        MRLQKAPLVTSGLVLGLLGLGNLLKDLSLTLNAVCGIFAFLIWIHLLCTMIKYFNNVKEQ
    Newman          MRLQKAPLVTSGLVLGLLGLGNLLKDLSLTLNAVCGIFAFLIWIHLLCTMIKYFNNVKEQ
    USA300_FPR3757  MRLQKAPLVTSGLVLGLLGLGNLLKDLSLTLNAVCGIFAFLIWIHLLCTMIKYFNNVKEQ
                    ************************************************************

    COL             LNSPLVSSVFTTFFMSGFLGTTYLNTFFSNITFINSLITPIWILCLVGIMTHMIIFSIKY
    N315            LNSPLVSSVFTTFFMSGFLGTTYLNTFFSNITFINSLITPIWILCLVGIMTHMIIFSIKY
    NCTC8325        LNSPLVSSVFTTFFMSGFLGTTYLNTFFSNITFINSLITPIWILCLVGIMTHMIIFSIKY
    Newman          LNSPLVSSVFTTFFMSGFLGTTYLNTFFSNITFINSLITPIWILCLVGIMTHMIIFSIKY
    USA300_FPR3757  LNSPLVSSVFTTFFMSGFLGTTYLNTFFSNITFINSLITPIWILCLVGIMTHMIIFSIKY
                    ************************************************************

    COL             LKDFSLENVYPSWTVLFIGIAIAGLTAPVSGYFFIGQLTVIYGFVATCIVLPIVFKRLKA
    N315            LKDFSLENVYPSWTVLFIGIAIAGLTAPVSGCFFIGQLTVIYGFVATCIVLPIVFKRLKA
    NCTC8325        LKDFSLENVYPSWTVLFIGIAIAGLTAPVSGYFFIGQLTVIYGFVATCIVLPIVFKRLKA
    Newman          LKDFSLENVYPSWTVLFIGIAIAGLTAPVSGYFFIGQLTVIYGFVATCIVLPIVFKRLKA
    USA300_FPR3757  LKDFSLKNVYPSWTVLFIGIAIAGLTAPVSGYFFIGQLTVIYGFVATCIVLPIVFKRLKA
                    ******:************************ ****************************

    COL             FPLQTSIKPNTSTICAPFSLVAAAYVIAFPKANAFIVIIFLLLAQIFYFYIIIQLPKLLK
    N315            FPLQTSIKPNTSTICAPFSLVAAAYVIAFPKANAFIVIIFLILAQIFYFYIIIQLPKLLK
    NCTC8325        FPLQTSIKPNTSTICAPFSLVAAAYVIAFPKANAFIVIIFLLLAQIFYFYIIIQLPKLLK
    Newman          FPLQTSIKPNTSTICAPFSLVAAAYVIAFPKANAFIVIIFLLLAQIFYFYIIIQLPKLLK
    USA300_FPR3757  FPLQTSIKPNTSTICAPFSLVAAAYVIAFPKANAFIVIIFLLLAQIFYFYIIIQLPKLLK
                    *****************************************:******************

    COL             EPFSPVFSAFTFPLVISATALKNSLPVLMFPDIWKGLLFIEVLLATVIVLRVFIGYLHFF
    N315            EPFSPVFSAFTFPLVISATALKNSLPVLMFPDIWKGLLFIEVLLATVIVLRVFIGYLHFF
    NCTC8325        EPFSPVFSAFTFPLVISATALKNSLPVLMFPDIWKGLLFIEVLLATVIVLRVFIGYLHFF
    Newman          EPFSPVFSAFTFPLVISATALKNSLPVLMFPDIWKGLLFIEVLLATVIVLRVFIGYLHFF
    USA300_FPR3757  EPFSPVFSAFTFPLVISATALKNSLPVLMFPDIWKGLLFIEVLLATVIVLRVFIGYLHFF
                    ************************************************************

    COL             LKKEKQDKFLRNASQ
    N315            LKKENQDKFLRNASQ
    NCTC8325        LKKEKQDKFLRNASQ
    Newman          LKKEKQDKFLRNASQ
    USA300_FPR3757  LKKEKQDKFLRNASQ
                    ****:**********