From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003441000
  • symbol?: psmβ2
  • description?: hemolytic protein

      descriptions from strain specific annotations:

    • hemolytic protein
    • anti protein (phenol soluble modulin)
    • anti protein
    • antibacterial protein
    • antibacterial protein (phenol soluble modulin)
    • haemolytic family protein
    • hemolytic family protein
    • Phenol soluble modulin beta 1
  • strand?: +
  • coordinates?: 3788539..3788679
  • synteny block?: BlockID0025220
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1132
    08BA02176:
    C248_1203
    11819-97:
    MS7_1131
    71193:
    ST398NM01_1171
    ECT-R 2:
    ECTR2_1030
    ED133:
    SAOV_1175
    ED98:
    SAAV_1145
    HO 5096 0412:
    SAEMRSA15_10070
    JH1:
    SaurJH1_1258
    JH9:
    SaurJH9_1233
    JKD6008:
    SAA6008_01128
    JKD6159:
    SAA6159_01025
    LGA251:
    SARLGA251_10850
    M013:
    M013TW_1108
    MRSA252:
    MSHR1132:
    SAMSHR1132_10160
    MSSA476:
    SAS1108
    Mu3:
    Mu50:
    MW2:
    MW1057
    RF122:
    ST398:
    SAPIG1171
    T0131:
    SAT0131_01219 (rplN)
    TCH60:
    TW20:
    SATW20_11680
    USA300_TCH1516:
    USA300HOU_1113
    VC40:
    SAVC_05030

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF
    NCTC8325        MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF
    USA300_FPR3757  MTGLAEAIANTVQAAQQHDSVKLGTSIVDIVANGVGLLGKLFGF
                    ********************************************