From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003446000
  • symbol?: bshC
  • description?: bacillithiol biosynthesis cysteine-adding enzyme BshC

      descriptions from strain specific annotations:

    • bacillithiol biosynthesis cysteine-adding enzyme BshC
    • Putative cysteine ligase BshC
    • membrane spanning protein
  • strand?: +
  • coordinates?: 3790262..3791883
  • synteny block?: BlockID0025270
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1135
    08BA02176:
    C248_1206
    11819-97:
    MS7_1134 (bshC)
    71193:
    ST398NM01_1174
    ECT-R 2:
    ECTR2_1033
    ED133:
    SAOV_1178
    ED98:
    SAAV_1148
    HO 5096 0412:
    SAEMRSA15_10100
    JH1:
    SaurJH1_1261
    JH9:
    SaurJH9_1236
    JKD6008:
    SAA6008_01131
    JKD6159:
    SAA6159_01028
    LGA251:
    SARLGA251_10880
    M013:
    M013TW_1111
    MRSA252:
    SAR1153
    MSHR1132:
    SAMSHR1132_10190
    MSSA476:
    SAS1111
    Mu3:
    SAHV_1167
    Mu50:
    SAV1177
    MW2:
    MW1060
    RF122:
    SAB1041
    ST398:
    SAPIG1174
    T0131:
    SAT0131_01222 (rpmC)
    TCH60:
    HMPREF0772_12055
    TW20:
    SATW20_11710
    USA300_TCH1516:
    USA300HOU_1117
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDCKVVSLNEKDQFIPKIKSSDPVITGLFQYDAAQQTSFEKRMSKENNGREAALANVIRE
    N315            MDCKVVSLNEKDQFIPKIKSSDPVITGLFQYDAAQQTSFEKRMSKENNGREAALANVIRE
    Newman          MDCKVVSLNEKDQFIPKIKSSDPVITGLFQYDAAQQTSFEKRMSKENNGREAALANVIRE
    USA300_FPR3757  MDCKVVSLNEKDQFIPKIKSSDPVITGLFQYDAAQQTSFEKRMSKENNGREAALANVIRE
                    ************************************************************

    COL             YMSDLKLSSEQELNIQHLANGSKVVIGGQQAGLFGGPLYTFHKIFSIITLSKELTDTHKQ
    N315            YMSDLKLSNEQELNIQHLANGSKVVIGGQQAGLFGGPLYTFHKIFSIITLSKELTDTHKQ
    Newman          YMSDLKLSSEQELNIQHLANGSKVVIGGQQAGLFGGPLYTFHKIFSIITLSKELTDTHKQ
    USA300_FPR3757  YMSDLKLSSEQELNIQHLANGSKVVIGGQQAGLFGGPLYTFHKIFSIITLSKELTDTHKQ
                    ********.***************************************************

    COL             QVVPVFWIAGEDHDFDEVNHTFVYNENHGSLHKVKYHTMEMPETTVSRYYPDKAELKQTL
    N315            QVVPVFWIAGEDHDFDEVNHTFVYNENHGSLHKVKYHTMEMPETTVSRYYPDKAELKQTL
    Newman          QVVPVFWIAGEDHDFDEVNHTFVYNENHGSLHKVKYHTMEMPETTVSRYYPDKAELKQTL
    USA300_FPR3757  QVVPVFWIAGEDHDFDEVNHTFVYNENHGSLHKVKYHTMEMPETTVSRYYPDKAELKQTL
                    ************************************************************

    COL             KTMFIHMKETVHTQGLLEICDRIIDQYDSWTDMFKALLHETFKAYGVLFIDAQFEPLRKM
    N315            KTMFIHMKETVHTQGLLEICDRIIDQYDSWTDMFKALLHETFKAYGVLFIDAQFEPLRKM
    Newman          KTMFIHMKETVHTQGLLEICDRIIDQYDSWTDMFKALLHETFKAYGVLFIDAQFEPLRKM
    USA300_FPR3757  KTMFIHMKETVHTQGLLEICDRIIDQYDSWTDMFKALLHETFKAYGVLFIDAQFEPLRKM
                    ************************************************************

    COL             EAPMFKKILKKHQLLDDAFRATQQRTQNQGLNAMIQTDTNVHLFLHDENMRQLVSYDGKH
    N315            EAPMFKKILKKHQLLDDAFRATQQRTQNQGLNAMIQTDTNVHLFLHDENMRQLVSYDGKH
    Newman          EAPMFKKILKKHQLLDDAFRATQQRTQNQGLNAMIQTDTNVHLFLHDENMRQLVSYDGKH
    USA300_FPR3757  EAPMFKKILKKHQLLDDAFRATQQRTQNQGLNAMIQTDTNVHLFLHDENMRQLVSYDGKH
                    ************************************************************

    COL             FKLNKTDKTYIKEEIINIAENQPELFSNNVVTRPLMEEWLFNTVAFVGGPSEIKYWAELK
    N315            FKLNKTDKTYIKEEIINIAENQPELFSNNVVTRPLMEEWLFNTVAFVGGPSEIKYWAELK
    Newman          FKLNKTDKTYIKEEIINIAENQPELFSNNVVTRPLMEEWLFNTVAFVGGPSEIKYWAELK
    USA300_FPR3757  FKLNKTDKTYIKEEIINIAENQPELFSNNVVTRPLMEEWLFNTVAFVGGPSEIKYWAELK
                    ************************************************************

    COL             DVFELFDVEMPIVMPRLRITYLNDRIEKLLSKYNIPLEKVLVDGVEGERSKFIREQASHQ
    N315            DVFELFDVEMPIVMPRLRITYLNDRIEKLLSKYNIPLEKVLVDGVEGERSKFIREQASHQ
    Newman          DVFELFDVEMPIVMPRLRITYLNDRIEKLLSKYNIPLEKVLVDGVEGERSKFIREQASHQ
    USA300_FPR3757  DVFELFDVEMPIVMPRLRITYLNDRIEKLLSKYNIPLEKVLVDGVEGERSKFIREQASHQ
                    ************************************************************

    COL             FIEKVEGMIEQQRRLNKDLLDEVAGNQNNINLVNKNNEIHIQQYDYLLKRYLLNIEREND
    N315            FIEKVEGMIEQQRRLNKDLLDEVAGNQNNINLVNKNNEIHIQQYDYLLKRYLLNIEREND
    Newman          FIEKVEGMIEQQRRLNKDLLDEVAGNQNNINLVNKNNEIHIQQYDYLLKRYLLNIEREND
    USA300_FPR3757  FIEKVEGMIEQQRRLNKDLLDEVAGNQNNINLVNKNNEIHIQQYDYLLKRYLLNIEREND
                    ************************************************************

    COL             ISMKQFREIQETLHPMGGLQERIWNLLQILNDFGTDVFKPSTYPPLSYTFDHIIIKP
    N315            ISMKQFREIQETLHPMGGLQERIWNPLQILNDFGTDVFKPSTYPPLSYTFDHIIIKP
    Newman          ISMKQFREIQETLHPMGGLQERIWNPLQILNDFGTDVFKPSTYPPLSYTFDHIIIKP
    USA300_FPR3757  ISMKQFREIQETLHPMGGLQERIWNPLQILNDFGTDVFKPSTYPPLSYTFDHIIIKP
                    ************************* *******************************