From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003448000
  • symbol?: mraZ
  • description?: cell division protein MraZ

      descriptions from strain specific annotations:

    • cell division protein MraZ
    • division/cell wall cluster transcriptional repressor MraZ
    • mraZ family protein
    • MraZ protein
    • protein mraZ
    • truncated cell division protein MraZ
  • strand?: +
  • coordinates?: 3792028..3792461
  • synteny block?: BlockID0025280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1191 (mraZ)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1136 (mraZ)
    08BA02176:
    C248_1207 (mraZ)
    11819-97:
    MS7_1135
    71193:
    ST398NM01_1175
    ECT-R 2:
    ECTR2_1034
    ED133:
    SAOV_1179
    ED98:
    SAAV_1149 (mraZ)
    HO 5096 0412:
    SAEMRSA15_10110
    JH1:
    SaurJH1_1262
    JH9:
    SaurJH9_1237
    JKD6008:
    SAA6008_01132 (mraZ)
    JKD6159:
    SAA6159_01029 (mraZ)
    LGA251:
    SARLGA251_10890
    M013:
    M013TW_1112
    MRSA252:
    SAR1154
    MSHR1132:
    SAMSHR1132_10200
    MSSA476:
    SAS1112
    Mu3:
    SAHV_1168
    Mu50:
    SAV1178
    MW2:
    MW1061
    RF122:
    SAB1042
    ST398:
    SAPIG1175 (mraZ)
    T0131:
    SAT0131_01223 (rplP)
    TCH60:
    HMPREF0772_12054 (mraZ)
    TW20:
    SATW20_11720
    USA300_TCH1516:
    USA300HOU_1118
    VC40:
    SAVC_05055

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGLDKCLFGYTLDEWQQIEEKMKTLPM
    N315            MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGLDKCLFGYTLDEWQQIEEKMKTLPM
    NCTC8325        MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGLDKCLFGYTLDEWQQIEEKMKTLPM
    Newman          MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGLDKCLFGYTLDEWQQIEEKMKTLPM
    USA300_FPR3757  MFMGEYDHQLDTKGRMIIPSKFRYDLNERFIITRGLDKCLFGYTLDEWQQIEEKMKTLPM
                    ************************************************************

    COL             TKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIWDRETW
    N315            TKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIWDRETW
    NCTC8325        TKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIWDRETW
    Newman          TKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIWDRETW
    USA300_FPR3757  TKKDARKFMRMFFSGAVEVELDKQGRINIPQNLRKYANLTKECTVIGVSNRIEIWDRETW
                    ************************************************************

    COL             NDFYEESEESFEDIAEDLIDFDF
    N315            NDFYEESEESFEDIAEDLIDFDF
    NCTC8325        NDFYEESEESFEDIAEDLIDFDF
    Newman          NDFYEESEESFEDIAEDLIDFDF
    USA300_FPR3757  NDFYEESEESFEDIAEDLIDFDF
                    ***********************