From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003450000
  • symbol?: ftsL
  • description?: cell division protein

      descriptions from strain specific annotations:

    • cell division protein
    • cell division protein FtsL
    • putative cell division protein
    • cell division septum formation protein FtsL
    • cell division and chromosome partitioning protein, FtsL
    • FtsL protein
  • strand?: +
  • coordinates?: 3793396..3793827
  • synteny block?: BlockID0025300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1023 (ftsL)
    NCTC8325:
    Newman:
    NWMN_1090 (ftsL)
    USA300_FPR3757:
    04-02981:
    SA2981_1138 (ftsL)
    08BA02176:
    C248_1209
    11819-97:
    MS7_1137 (ftsL)
    71193:
    ST398NM01_1177
    ECT-R 2:
    ECTR2_1036 (ftsL)
    ED133:
    SAOV_1181
    ED98:
    SAAV_1151
    HO 5096 0412:
    SAEMRSA15_10130
    JH1:
    SaurJH1_1264
    JH9:
    SaurJH9_1239
    JKD6008:
    SAA6008_01134 (ftsL)
    JKD6159:
    SAA6159_01031 (ftsL)
    LGA251:
    SARLGA251_10910
    M013:
    M013TW_1114
    MRSA252:
    SAR1156
    MSHR1132:
    SAMSHR1132_10220
    MSSA476:
    SAS1114
    Mu3:
    SAHV_1170 (ftsL)
    Mu50:
    SAV1180 (ftsL)
    MW2:
    MW1063 (ftsL)
    RF122:
    SAB1044
    ST398:
    SAPIG1177
    T0131:
    SAT0131_01225
    TCH60:
    HMPREF0772_12052 (ftsL)
    TW20:
    SATW20_11740
    USA300_TCH1516:
    USA300HOU_1120 (ftsL)
    VC40:
    SAVC_05065

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----MYQPYDEQVYNSIPKQQPQTKPEKKTVSRKVVVQLTKFEKVLYITLITVIAMLSI
    N315            MAVEKVYQPYDEQVYNSIPKQQPQTKPEKKTVSRKVVVQLTKFEKVLYITLITVIAMLSI
    NCTC8325        MAVEKVYQPYDEQVYNSIPKQQPQTKPEKKTVSRKVVVQLTKFEKVLYITLITVIAMLSI
    Newman          MAVEKVYQPYDEQVYNSIPKQQPQTKPEKKTVSRKVVVQLTKFEKVLYITLITVIAMLSI
    USA300_FPR3757  MAVEKVYQPYDEQVYNSIPKQQPQTKPEKKTVSRKVVVQLTKFEKVLYITLITVIAMLSI
                         :******************************************************

    COL             YMLSLKMDAYDTRGKIADLDYKIDKQSSENSALQSEIKKNSSYERIYEKAKKQGMSLEND
    N315            YMLSLKMDAYDTRGKIADLDYKIDKQSSENSALQSEIKKNSSYERIYEKAKKQGMSLEND
    NCTC8325        YMLSLKMDAYDTRGKIADLDYKIDKQSSENSALQSEIKKNSSYERIYEKAKKQGMSLEND
    Newman          YMLSLKMDAYDTRGKIADLDYKIDKQSSENSALQSEIKKNSSYERIYEKAKKQGMSLEND
    USA300_FPR3757  YMLSLKMDAYDTRGKIADLDYKIDKQSSENSALQSEIKKNSSYERIYEKAKKQGMSLEND
                    ************************************************************

    COL             NVKVVRSNGEAKN
    N315            NVKVVRSNGEAKN
    NCTC8325        NVKVVRSNGEAKN
    Newman          NVKVVRSNGEAKN
    USA300_FPR3757  NVKVVRSNGEAKN
                    *************