From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003456000
  • symbol?: ftsZ
  • description?: cell division protein FtsZ
  • strand?: +
  • coordinates?: 3801568..3802740
  • synteny block?: BlockID0025360
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1199 (ftsZ)
    N315:
    SA1029 (ftsZ)
    NCTC8325:
    Newman:
    NWMN_1096 (ftsZ)
    USA300_FPR3757:
    04-02981:
    SA2981_1144 (ftsZ)
    08BA02176:
    C248_1215 (ftsZ)
    11819-97:
    MS7_1143 (ftsZ)
    71193:
    ST398NM01_1183
    ECT-R 2:
    ECTR2_1042 (ftsZ)
    ED133:
    SAOV_1187 (ftsZ)
    ED98:
    SAAV_1157 (ftsZ)
    HO 5096 0412:
    SAEMRSA15_10190 (ftsZ)
    JH1:
    SaurJH1_1270
    JH9:
    SaurJH9_1245
    JKD6008:
    SAA6008_01140 (ftsZ)
    JKD6159:
    SAA6159_01037 (ftsZ)
    LGA251:
    SARLGA251_10970 (ftsZ)
    M013:
    M013TW_1120
    MRSA252:
    SAR1162 (ftsZ)
    MSHR1132:
    SAMSHR1132_10280
    MSSA476:
    SAS1120
    Mu3:
    SAHV_1176 (ftsZ)
    Mu50:
    SAV1186 (ftsZ)
    MW2:
    MW1069 (ftsZ)
    RF122:
    SAB1050 (ftsZ)
    ST398:
    SAPIG1183 (ftsZ)
    T0131:
    SAT0131_01232
    TCH60:
    HMPREF0772_12046 (ftsZ)
    TW20:
    SATW20_11800 (ftsZ)
    USA300_TCH1516:
    VC40:
    SAVC_05095

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLEFEQGFNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQ
    N315            MLEFEQGFNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQ
    NCTC8325        MLEFEQGFNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQ
    Newman          MLEFEQGFNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQ
    USA300_FPR3757  MLEFEQGFNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQ
                    ************************************************************

    COL             IGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKI
    N315            IGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKI
    NCTC8325        IGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKI
    Newman          IGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKI
    USA300_FPR3757  IGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKI
                    ************************************************************

    COL             AKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMM
    N315            AKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMM
    NCTC8325        AKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMM
    Newman          AKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMM
    USA300_FPR3757  AKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMM
                    ************************************************************

    COL             EAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEA
    N315            EAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEA
    NCTC8325        EAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEA
    Newman          EAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEA
    USA300_FPR3757  EAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEA
                    ************************************************************

    COL             AKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINP
    N315            AKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINP
    NCTC8325        AKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINP
    Newman          AKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINP
    USA300_FPR3757  AKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINP
                    ************************************************************

    COL             ELQDEIVVTVIATGFDDKPTSHGRKSGSTGFGTSVNTSSNATSKDESFTSNSSNAQATDS
    N315            ELQDEIVVTVIATGFDDKPTSHGRKSGSTGFGTSVNTSSNATSKDESFTSNSSNAQATDS
    NCTC8325        ELQDEIVVTVIATGFDDKPTSHGRKSGSTGFGTSVNTSSNATSKDESFTSNSSNAQATDS
    Newman          ELQDEIVVTVIATGFDDKPTSHGRKSGSTGFGTSVNTSSNATSKDESFTSNSSNAQATDS
    USA300_FPR3757  ELQDEIVVTVIATGFDDKPTSHGRKSGSTGFGTSVNTSSNATSKDESFTSNSSNAQATDS
                    ************************************************************

    COL             VSERTHTTKEDDIPSFIRNREERRSRRTRR
    N315            VSERTHTTKEDDIPSFIRNREERRSRRTRR
    NCTC8325        VSERTHTTKEDDIPSFIRNREERRSRRTRR
    Newman          VSERTHTTKEDDIPSFIRNREERRSRRTRR
    USA300_FPR3757  VSERTHTTKEDDIPSFIRNREERRSRRTRR
                    ******************************