From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003462000
  • symbol?:
  • description?: RNA-binding S4 domain-containing protein

      descriptions from strain specific annotations:

    • RNA-binding S4 domain-containing protein
    • RNA-binding S4 domain protein
    • YlmH protein
    • pseudogene
    • S4 RNA binding domain protein
    • MW1074 protein
    • S4 domain-containing protein YlmH
    • RNA binding protein
    • ribosomal protein S4
  • strand?: +
  • coordinates?: 3805439..3806280
  • synteny block?: BlockID0025420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1204 (ylmH)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1149
    08BA02176:
    C248_1220
    11819-97:
    MS7_1148
    71193:
    ST398NM01_1189
    ECT-R 2:
    ECTR2_1047
    ED133:
    SAOV_1192
    ED98:
    SAAV_1162
    HO 5096 0412:
    SAEMRSA15_10240
    JH1:
    SaurJH1_1275
    JH9:
    SaurJH9_1250
    JKD6008:
    SAA6008_01145
    JKD6159:
    SAA6159_01042
    LGA251:
    SARLGA251_11020
    M013:
    M013TW_1125
    MRSA252:
    SAR1167
    MSHR1132:
    SAMSHR1132_10330
    MSSA476:
    SAS1125
    Mu3:
    SAHV_1181
    Mu50:
    SAV1191
    MW2:
    MW1074
    RF122:
    SAB1055
    ST398:
    SAPIG1189
    T0131:
    SAT0131_01238 (glcU)
    TCH60:
    HMPREF0772_12041 (ylmH)
    TW20:
    SATW20_11850
    USA300_TCH1516:
    USA300HOU_1128
    VC40:
    SAVC_05120

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------MINIDIYQHFRQEEYELIDQLTDKCDQAEQHYAPVLTHFLDPRGQYILEVI
    N315            --------------------------------------------------------MEVI
    NCTC8325        MVFYNFFKVVINIDIYQHFRQEEYELIDQLTDKCDQAEQHYAPVLTHFLDPRGQYILEVI
    Newman          MVFYNFFKVVINIDIYQHFRQEEYELIDQLTDKCDQAEQHYAPVLTHFLDPRGQYILEVI
    USA300_FPR3757  MVFYNFFKVVINIDIYQHFRQEEYELIDQLTDKCDQAEQHYAPVLTHFLDPRGQYILEVI
                                                                            :***

    COL             CGSYEDLNVSFYGGPNAERKRAIISPNYYEPKESDFELTLMEIDYPEKFVTLKHQHILGT
    N315            CGSYEDLNVSFYGGPNAERKRAIISPNYYEPKESDFELTLMEIEYPEKFVTLKHQHILGT
    NCTC8325        CGSYEDLNVSFYGGPNAERKRAIISPNYYEPKESDFELTLMEIDYPEKFVTLKHQHILGT
    Newman          CGSYEDLNVSFYGGPNAERKRAIISPNYYEPKESDFELSLMQIDYPEKFVTLKHQHILGT
    USA300_FPR3757  CGSYEDLNVSFYGGPNAERKRAIISPNYYEPKESDFELTLMEIDYPEKFVTLKHQHILGT
                    **************************************:**:*:****************

    COL             LMSLGIEREQVGDIIVNERIQFVLTSRLESFIMLELQRIKGASVKLYTIPVTDMIQSNEN
    N315            LMSLGIEREQVGDIIVNERIQFVLTSRLESFIMLELQRIKGASVKLYTIPVTDMIQSNEN
    NCTC8325        LMSLGIEREQVGDIIVNERIQFVLTSRLESFIMLELQRIKGASVKLYTIPVTDMIQSNEN
    Newman          LMSLGIEREQVGDIIVNERIQFVLTSRLESFIMLELQRIKGASVKLYTIPVTDMIQSNEN
    USA300_FPR3757  LMSLGIEREQVGDIIVNERIQFVLTSRLESFIMLELQRIKGASVKLYTIPVTDMIQSNEN
                    ************************************************************

    COL             WKNESATVSSLRLDVVIKEMIRKSRTIAKQLIEKKRVKVNHTIVDSADFQLQANDLISIQ
    N315            WKNESATVSSLRLDVVIKEMIRKSRTIAKQLIEKKRVKVNHTIVDSADFQLQANDLISIQ
    NCTC8325        WKNESATVSSLRLDVVIKEMIRKSRTIAKQLIEKKRVKVNHTIVDSADFQLQANDLISIQ
    Newman          WKNESATVSSLRLDVVIKYLIRKSRTIAKGGGEKKRVKVNHTIVDSADFQLQANDLISIQ
    USA300_FPR3757  WKNESATVSSLRLDVVIKEMIRKSRTIAKQLIEKKRVKVNHTIVDSADFQLQANDLISIQ
                    ****************** :*********   ****************************

    COL             GFGRAHITDLGGKTKKDKTHITYRTLFK
    N315            GFGRAHITDLGGKTKKDKTHITYRTLFK
    NCTC8325        GFGRAHITDLGGKTKKDKTHITYRTLFK
    Newman          GFGRAHITDLGGKTKKDKTHITYRTLFK
    USA300_FPR3757  GFGRAHITDLGGKTKKDKTHITYRTLFK
                    ****************************