From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003463000
  • symbol?:
  • description?: cell division initiation protein

      descriptions from strain specific annotations:

    • cell division initiation protein
    • Cell division initiation protein DivIVA
    • putative cell-division initiation protein
    • DivIVA family protein
    • cell-divisio initiation protein
    • DivIVA protein
  • strand?: +
  • coordinates?: 3806304..3806930
  • synteny block?: BlockID0025430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1150
    08BA02176:
    C248_1221
    11819-97:
    MS7_1149
    71193:
    ST398NM01_1190
    ECT-R 2:
    ECTR2_1048
    ED133:
    SAOV_1193
    ED98:
    SAAV_1163
    HO 5096 0412:
    SAEMRSA15_10250
    JH1:
    SaurJH1_1276
    JH9:
    SaurJH9_1251
    JKD6008:
    SAA6008_01146
    JKD6159:
    SAA6159_01043
    LGA251:
    SARLGA251_11030
    M013:
    M013TW_1126
    MRSA252:
    SAR1168
    MSHR1132:
    SAMSHR1132_10340
    MSSA476:
    SAS1126
    Mu3:
    SAHV_1182
    Mu50:
    SAV1192
    MW2:
    MW1075
    RF122:
    SAB1056
    ST398:
    SAPIG1190
    T0131:
    SAT0131_01239
    TCH60:
    HMPREF0772_12040
    TW20:
    SATW20_11860
    USA300_TCH1516:
    USA300HOU_1129
    VC40:
    SAVC_05125

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPFTPNEIKNKEFSRVKNGLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEERDTNIKSY
    N315            MPFTPNEIKNKEFSRVKNGLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEERDTNIKSY
    NCTC8325        MPFTPNEIKNKEFSRVKNGLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEERDTNIKSY
    Newman          MPFTPNEIKNKEFSRVKNGLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEERDTNIKSY
    USA300_FPR3757  MPFTPNEIKNKEFSRVKNGLEPTEVANFLEQLSTEIERLKEDKKQLEKVIEERDTNIKSY
                    ************************************************************

    COL             QDVHQSVSDALIQAQKAGEETKQAAEKQAEAIIAKAEAQANQMVGDAVEKARRLAFQTED
    N315            QDVHQSVSDALIQAQKAGEETKQAAEKQAEAIIAKAEAQANQMVGDAVEKARRLAFQTED
    NCTC8325        QDVHQSVSDALIQAQKAGEETKQAAEKQAEAIIAKAEAQANQMVGDAVEKARRLAFQTED
    Newman          QDVHQSVSDALIQAQKAGEETKQAAEKQAEAIIAKAEAQANQMVGDAVEKARRLAFQTED
    USA300_FPR3757  QDVHQSVSDALIQAQKAGEETKQAAEKQAEAIIAKAEAQANQMVGDAVEKARRLAFQTED
                    ************************************************************

    COL             MKRQSKVFRSRFRMLVEAQLDLLKNEDWDYLLNYDLDAEQVTLENIHHLHENDLKPDEVA
    N315            MKRQSKVFRSRFRMLVEAQLDLLKNEDWDYLLNYDLDAEQVTLENIHHLHENDLKPDEVA
    NCTC8325        MKRQSKVFRSRFRMLVEAQLDLLKNEDWDYLLNYDLDAEQVTLENIHHLHENDLKPDEVA
    Newman          MKRQSKVFRSRFRMLVEAQLDLLKNEDWDYLLNYDLDAEQVTLENIHHLHENDLKPDEVA
    USA300_FPR3757  MKRQSKVFRSRFRMLVEAQLDLLKNEDWDYLLNYDLDAEQVTLENIHHLHENDLKPDEVA
                    ************************************************************

    COL             ANAQNNASNTPDNNQQSNDSETTKK
    N315            ANAQNNASNTPDNNQQSNDSETTKK
    NCTC8325        ANAQNNASNTPDNNQQSNDSETTKK
    Newman          ANAQNNASNTPDNNQQSNDSETTKK
    USA300_FPR3757  ANAQNNASNTPDNNQQSNDSETTKK
                    *************************