From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN003472000
  • symbol?:
  • description?: transposase

      descriptions from strain specific annotations:

    • transposase
    • pseudogene
    • truncated transposase
    • putative transposase
    • transposase DDE domain protein
  • strand?: +
  • coordinates?: 3812221..3814283
  • synteny block?: BlockID0025520
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1038 (tnp)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1153
    08BA02176:
    11819-97:
    MS7_1152
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_10280
    JH1:
    SaurJH1_1279
    JH9:
    SaurJH9_1254
    JKD6008:
    SAA6008_01149
    JKD6159:
    LGA251:
    SARLGA251_11060
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS1129
    Mu3:
    SAHV_1185
    Mu50:
    SAV1195 (truncated-tnp)
    MW2:
    MW1078 (tnp)
    RF122:
    ST398:
    T0131:
    SAT0131_01242 (metE)
    TCH60:
    TW20:
    SATW20_11890
    USA300_TCH1516:
    USA300HOU_1132
    VC40:
    SAVC_05140

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MLSFTRMSVRGINKVKRELGFVLMALNIRKIAAQRAVHYKIHIKKADFYQIINRNQLFTL
    NCTC8325        -MSFTRMSVRGINKVKRELGFVLMAINIRKIAAQRAVHYKIHIKKADFYQIINRNQLFTL
    Newman          -MSFTRMSVRGINKVKRELGFVLMAINIRKIAAQRAVHYKIHIKKADFYQIINRNQLFTL
                     :***********************:**********************************

    N315            PKNLMSQPPS
    NCTC8325        PKNLMSQPPS
    Newman          PKNLMSQPPS
                    **********