From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003478000
  • symbol?: pyrR
  • description?: bifunctional pyrimidine operon transcriptional regulator/uracil phosphoribosyltransferase

      descriptions from strain specific annotations:

    • bifunctional pyrimidine operon transcriptional regulator/uracil phosphoribosyltransferase
    • bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase
    • bifunctional pyrimidine regulatory protein PyrR/uracil phosphoribosyltransferase
    • bifunctional [pyrimidine operon regulatory protein/uracil phosphoribosyltransferase
    • bifunctional protein pyrimidine operon regulatory protein/uracil phosphoribosyltransferase, PyrR
    • bifunctional protein PyrR
    • bifunctional protein PyrR pyrimidine operon regulatory protein
    • bifunctional pyrimidine operon regulatory protein/uracil hosphoribosyltransferase
    • phosphoribosyl transferase/pyrimidine operon regulatory protein
    • putative pyrimidine operon regulatory protein
    • PyrR bifunctional protein
    • PyrR protein
    • Uracil phosphoribosyltransferase / Pyrimidine operon regulatory protein PyrR
  • strand?: +
  • coordinates?: 3817499..3818026
  • synteny block?: BlockID0025570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1210 (pyrR)
    N315:
    SA1041 (pyrR)
    NCTC8325:
    Newman:
    NWMN_1109 (pryR)
    USA300_FPR3757:
    04-02981:
    SA2981_1156 (pyrR)
    08BA02176:
    C248_1227 (pyrR)
    11819-97:
    MS7_1155 (pyrR)
    71193:
    ST398NM01_1195
    ECT-R 2:
    ECTR2_1053
    ED133:
    SAOV_1201
    ED98:
    SAAV_1169 (pyrR)
    HO 5096 0412:
    SAEMRSA15_10310 (pyrR)
    JH1:
    SaurJH1_1282
    JH9:
    SaurJH9_1257
    JKD6008:
    SAA6008_01152 (pyrR)
    JKD6159:
    SAA6159_01051 (pyrR)
    LGA251:
    SARLGA251_11090 (pyrR)
    M013:
    M013TW_1133
    MRSA252:
    SAR1174 (pyrR)
    MSHR1132:
    SAMSHR1132_10390
    MSSA476:
    SAS1132
    Mu3:
    SAHV_1188 (pyrR)
    Mu50:
    SAV1198 (pyrR)
    MW2:
    MW1081 (pyrR)
    RF122:
    SAB1062 (pyrR)
    ST398:
    SAPIG1195
    T0131:
    SAT0131_01245 (fmhB)
    TCH60:
    HMPREF0772_12034 (upp2)
    TW20:
    SATW20_11920 (pyrR)
    USA300_TCH1516:
    USA300HOU_1136 (pyrR)
    VC40:
    SAVC_05155

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSERIIMDDAAIQRTVTRIAHEILEYNKGTDNLILLGIKTRGEYLANRIQDKIHQIEQQR
    N315            MSERIIMDDAAIQRTVTRIAHEILEYNKGTDNLILLGIKTRGEYLANRIQDKIHQIEQQR
    NCTC8325        MSERIIMDDAAIQRTVTRIAHEILEYNKGTDNLILLGIKTRGEYLANRIQDKIHQIEQQR
    Newman          MSERIIMDDAAIQRTVTRIAHEILEYNKGTDNLILLGIKTRGEYLANRIQDKIHQIEQQR
    USA300_FPR3757  MSERIIMDDAAIQRTVTRIAHEILEYNKGTDNLILLGIKTRGEYLANRIQDKIHQIEQQR
                    ************************************************************

    COL             IPTGTIDITYFRDDIEHMSSLTTKDAIDIDTDITDKVVIIIDDVLYTGRTVRASLDAILL
    N315            IPTGTIDITYFRDDIEHMSSLTTKDAIDIDTDITDKVVIIIDDVLYTGRTVRASLDAILL
    NCTC8325        IPTGTIDITYFRDDIEHMSSLTTKDAIDIDTDITDKVVIIIDDVLYTGRTVRASLDAILL
    Newman          IPTGTIDITYFRDDIEHMSSLTTKDAIDIDTDITDKVVIIIDDVLYTGRTVRASLDAILL
    USA300_FPR3757  IPTGTIDITYFRDDIEHMSSLTTKDAIDIDTDITDKVVIIIDDVLYTGRTVRASLDAILL
                    ************************************************************

    COL             NARPIKIGLAALVDRGHRELPIRADFVGKNIPTSKEETVSVYLEEMDQRNAVIIK
    N315            NARPIKIGLAALVDRGHRELPIRADFVGKNIPTSKEETVSVYLEEMDQRNAVIIK
    NCTC8325        NARPIKIGLAALVDRGHRELPIRADFVGKNIPTSKEETVSVYLEEMDQRNAVIIK
    Newman          NARPIKIGLAALVDRGHRELPIRADFVGKNIPTSKEETVSVYLEEMDQRNAVIIK
    USA300_FPR3757  NARPIKIGLAALVDRGHRELPIRADFVGKNIPTSKEETVSVYLEEMDQRNAVIIK
                    *******************************************************