From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan003480000
  • symbol?: pyrB
  • description?: aspartate carbamoyltransferase

      descriptions from strain specific annotations:

    • aspartate carbamoyltransferase
    • aspartate carbamoyltransferase catalytic subunit
    • aspartate carbamoyltransferase catalytic chain A
    • putative aspartate carbamoyltransferase
  • strand?: +
  • coordinates?: 3819583..3820353
  • synteny block?: BlockID0025590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1212 (pyrB)
    N315:
    SA1043 (pyrB)
    NCTC8325:
    Newman:
    NWMN_1111 (pyrB)
    USA300_FPR3757:
    04-02981:
    SA2981_1158 (pyrB)
    08BA02176:
    C248_1229 (pyrB)
    11819-97:
    MS7_1157 (pyrB)
    71193:
    ST398NM01_1197
    ECT-R 2:
    ECTR2_1055 (pyrB)
    ED133:
    SAOV_1203
    ED98:
    SAAV_1171 (pyrB)
    HO 5096 0412:
    SAEMRSA15_10330 (pyrB)
    JH1:
    SaurJH1_1284 (pyrB)
    JH9:
    SaurJH9_1259 (pyrB)
    JKD6008:
    SAA6008_01154 (pyrB)
    JKD6159:
    SAA6159_01053 (pyrB)
    LGA251:
    SARLGA251_11110 (pyrB)
    M013:
    M013TW_1135
    MRSA252:
    SAR1176 (pyrB)
    MSHR1132:
    SAMSHR1132_10410
    MSSA476:
    SAS1134 (pyrB)
    Mu3:
    SAHV_1190 (pyrB)
    Mu50:
    SAV1200 (pyrB)
    MW2:
    MW1083 (pyrB)
    RF122:
    SAB1064 (pyrB)
    ST398:
    SAPIG1197 (pyrB)
    T0131:
    SAT0131_01247
    TCH60:
    HMPREF0772_12032 (pyrB)
    TW20:
    SATW20_11940 (pyrB)
    USA300_TCH1516:
    USA300HOU_1138 (pyrB)
    VC40:
    SAVC_05165 (pyrB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
    N315            MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
    NCTC8325        MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
    Newman          MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
    USA300_FPR3757  MNHLLSMEHLSTDQIYKLIQKASQFKSGERQLPNFEGKYVANLFFENSTRTKCSFEMAEL
                    ************************************************************

    COL             KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
    N315            KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
    NCTC8325        KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
    Newman          KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
    USA300_FPR3757  KLGLKTISFETSTSSVSKGESLYDTCKTLESIGCDLLVIRHPFNNYYEKLANINIPIANA
                    ************************************************************

    COL             GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
    N315            GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
    NCTC8325        GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
    Newman          GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
    USA300_FPR3757  GDGSGQHPTQSLLDLMTIYEEYGYFEGLNVLICGDIKNSRVARSNYHSLKALGANVMFNS
                    ************************************************************

    COL             PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
    N315            PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
    NCTC8325        PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
    Newman          PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
    USA300_FPR3757  PNAWIDDSLEAPYVNIDDVIETVDIVMLLRIQHERHGLAEETRFAADDYHQKHGLNEVRY
                    ************************************************************

    COL             NKLQEHAIVMHPAPVNRGVEIQSDLVEASKSRIFKQMENGVYLRMAVIDELLK
    N315            NKLQEHAIVMHPAPVNRGVEIQSDLVEASKSRIFKQMENGVYLRMAVIDELLK
    NCTC8325        NKLQEHAIVMHPAPVNRGVEIQSDLVEASKSRIFKQMENGVYLRMAVIDELLK
    Newman          NKLQEHAIVMHPAPVNRGVEIQSDLVEASKSRIFKQMENGVYLRMAVIDELLK
    USA300_FPR3757  NKLQEHAIVMHPAPVNRGVEIQSDLVEASKSRIFKQMENGVYLRMAVIDELLK
                    *****************************************************