Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003492000
  • symbol?: rpoZ
  • description?: DNA-directed RNA polymerase subunit omega

      descriptions from strain specific annotations:

    • DNA-directed RNA polymerase subunit omega
    • DNA-directed RNA polymerase omega subunit
    • DNA-directed RNA polymerase, omega subunit
    • DNA-directed RNA polymerase omega chain
  • strand?: +
  • coordinates?: 3831731..3831949
  • synteny block?: BlockID0025710
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1222 (rpoZ)
    N315:
    SA1053 (rpoZ)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1168
    08BA02176:
    C248_1240 (rpoZ)
    11819-97:
    MS7_1168 (rpoZ)
    71193:
    ST398NM01_1208
    ECT-R 2:
    ECTR2_1066 (rpoZ)
    ED133:
    SAOV_1213
    ED98:
    SAAV_1182 (rpoZ)
    HO 5096 0412:
    SAEMRSA15_10430
    JH1:
    SaurJH1_1294 (rpoZ)
    JH9:
    SaurJH9_1269 (rpoZ)
    JKD6008:
    SAA6008_01165 (rpoZ)
    JKD6159:
    SAA6159_01063 (rpoZ)
    LGA251:
    SARLGA251_11210 (rpoZ)
    M013:
    M013TW_1148
    MRSA252:
    SAR1186 (rpoZ)
    MSHR1132:
    SAMSHR1132_10510
    MSSA476:
    SAS1144 (rpoZ)
    Mu3:
    SAHV_1200 (rpoZ)
    Mu50:
    SAV1210 (rpoZ)
    MW2:
    MW1093 (rpoZ)
    RF122:
    SAB1074 (rpoZ)
    ST398:
    SAPIG1208 (rpoZ)
    T0131:
    SAT0131_01259 (mobB)
    TCH60:
    HMPREF0772_12022 (rpoZ)
    TW20:
    SATW20_12040 (rpoZ)
    USA300_TCH1516:
    USA300HOU_1148 (rpoZ)
    VC40:
    SAVC_05215 (rpoZ)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLNPPLNQLTSQIKSKYLIATTAAKRAREIDEQPETELLSEYHSFKPVGRALEEIADGKI
    N315            MLNPPLNQLTSQIKSKYLIATTAAKRAREIDEQPETELLSEYHSFKPVGRALEEIADGKI
    NCTC8325        MLNPPLNQLTSQIKSKYLIATTAAKRAREIDEQPETELLSEYHSFKPVGRALEEIADGKI
    USA300_FPR3757  MLNPPLNQLTSQIKSKYLIATTAAKRAREIDEQPETELLSEYHSFKPVGRALEEIADGKI
                    ************************************************************

    COL             RPVISSDYYGKE
    N315            RPVISSDYYGKE
    NCTC8325        RPVISSDYYGKE
    USA300_FPR3757  RPVISSDYYGKE
                    ************