From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003498000
  • symbol?: def2
  • description?: peptide deformylase

      descriptions from strain specific annotations:

    • peptide deformylase
    • polypeptide deformylase family protein
    • putative polypeptide deformylase
    • Peptide deformylase-like protein
    • peptide deformylase 1
  • strand?: +
  • coordinates?: 3838075..3838563
  • synteny block?: BlockID0025770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1227 (def2)
    N315:
    NCTC8325:
    Newman:
    NWMN_1125 (def)
    USA300_FPR3757:
    04-02981:
    SA2981_1173
    08BA02176:
    C248_1245 (def)
    11819-97:
    MS7_1173
    71193:
    ST398NM01_1214
    ECT-R 2:
    ECTR2_1071
    ED133:
    SAOV_1218
    ED98:
    SAAV_1187 (def2)
    HO 5096 0412:
    SAEMRSA15_10480 (def)
    JH1:
    SaurJH1_1299
    JH9:
    SaurJH9_1274
    JKD6008:
    SAA6008_01170 (def2)
    JKD6159:
    SAA6159_01068 (def2)
    LGA251:
    SARLGA251_11260 (def)
    M013:
    M013TW_1153
    MRSA252:
    SAR1191 (def)
    MSHR1132:
    SAMSHR1132_10560
    MSSA476:
    SAS1149
    Mu3:
    SAHV_1205
    Mu50:
    SAV1215
    MW2:
    MW1098
    RF122:
    SAB1079 (def)
    ST398:
    SAPIG1214 (def)
    T0131:
    SAT0131_01264 (moeB)
    TCH60:
    HMPREF0772_12017 (def)
    TW20:
    SATW20_12090 (def)
    USA300_TCH1516:
    USA300HOU_1152 (def2)
    VC40:
    SAVC_05240

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAIKKLVPASHPILTKKAQAVKTFDDSLKRLLQDLEDTMYAQEAAGLCAPQINQSLQVAI
    N315            MAIKKLVPASHPILTKKAQAVKTFDDSLKRLLQDLEDTMYAQEAAGLCAPQINQSLQVAI
    NCTC8325        MAIKKLVPASHPILTKKAQAVKTFDDSLKRLLQDLEDTMYAQEAAGLCAPQINQSLQVAI
    Newman          MAIKKLVPASHPILTKKAQAVKTFDDSLKRLLQDLEDTMYAQEAAGLCAPQINQSLQVAI
    USA300_FPR3757  MAIKKLVPASHPILTKKAQAVKTFDDSLKRLLQDLEDTMYAQEAAGLCAPQINQSLQVAI
                    ************************************************************

    COL             IDMEMEGLLQLVNPKIISQSNETITDLEGSITLPDVYGEVTRSKMIVVESYDVNGNKVEL
    N315            IDMEMEGLLQLVNPKIISQSNETITDLEGSITLPDVYGEVTRSKMIVVESYDVNGNKVEL
    NCTC8325        IDMEMEGLLQLVNPKIISQSNETITDLEGSITLPDVYGEVTRSKMIVVESYDVNGNKVEL
    Newman          IDMEMEGLLQLVNPKIISQSNETITDLEGSITLPDVYGEVTRSKMIVVESYDVNGNKVEL
    USA300_FPR3757  IDMEMEGLLQLVNPKIISQSNETITDLEGSITLPDVYGEVTRSKMIVVESYDVNGNKVEL
                    ************************************************************

    COL             TAHEDVARMILHIIDQMNGIPFTERADRILTDKEVEAYFIND
    N315            TAHEDVARMILHIIDQMNGIPFTERADRILTDKEVEAYFIND
    NCTC8325        TAHEDVARMILHIIDQMNGIPFTERADRILTDKEVEAYFIND
    Newman          TAHEDVARMILHIIDQMNGIPFTERADRILTDKEVEAYFIND
    USA300_FPR3757  TAHEDVARMILHIIDQMNGIPFTERADRILTDKEVEAYFIND
                    ******************************************