From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003502000
  • symbol?: stp1
  • description?: PP2C protein phosphatase

      descriptions from strain specific annotations:

    • PP2C protein phosphatase
    • protein phosphatase 2C-like protein
    • protein phosphatase 2C domain-containing protein
    • Protein serine/threonine phosphatase PrpC, regulation of stationary phase
    • protein phosphatase 2C family protein
    • putative protein phosphatase
    • phosphoprotein phosphatase
    • protein phosphatase PrpC
    • serine/threonine protein phosphatase 1
  • strand?: +
  • coordinates?: 3841899..3842642
  • synteny block?: BlockID0025810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1177 (prpC)
    08BA02176:
    C248_1249
    11819-97:
    MS7_1177
    71193:
    ST398NM01_1218
    ECT-R 2:
    ECTR2_1075
    ED133:
    SAOV_1222
    ED98:
    SAAV_1191
    HO 5096 0412:
    SAEMRSA15_10520
    JH1:
    SaurJH1_1303
    JH9:
    SaurJH9_1278
    JKD6008:
    SAA6008_01174
    JKD6159:
    SAA6159_01072
    LGA251:
    SARLGA251_11300
    M013:
    M013TW_1157
    MRSA252:
    SAR1195
    MSHR1132:
    SAMSHR1132_10600
    MSSA476:
    SAS1153
    Mu3:
    SAHV_1209
    Mu50:
    SAV1219
    MW2:
    MW1102
    RF122:
    SAB1083
    ST398:
    SAPIG1218
    T0131:
    SAT0131_01268
    TCH60:
    HMPREF0772_12013 (pphA)
    TW20:
    SATW20_12130
    USA300_TCH1516:
    USA300HOU_1156
    VC40:
    SAVC_05260

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLEAQFFTDTGQHRDKNEDAGGIFYNQTNQQLLVLCDGMGGHKAGEVASKFVTDELKSRF
    N315            MLEAQFFTDTGQHRDKNEDAGGIFYNQTNQQLLVLCDGMGGHKAGEVASKFVTDELKSRF
    NCTC8325        MLEAQFFTDTGQHRDKNEDAGGIFYNQTNQQLLVLCDGMGGHKAGEVASKFVTDELKSRF
    Newman          MLEAQFFTDTGQHRDKNEDAGGIFYNQTNQQLLVLCDGMGGHKAGEVASKFVTDELKSRF
    USA300_FPR3757  MLEAQFFTDTGQHRDKNEDAGGIFYNQTNQQLLVLCDGMGGHKAGEVASKFVTDELKSRF
                    ************************************************************

    COL             EAENLIEQHQAENWLRNNIKDINFQLYHYAQENAEYKGMGTTCVCALVFEKSVVIANVGD
    N315            EAENLIEEHQAENWLRNNIKDINFQLYHYAQENAEYKGMGTTCVCALVFEKSVVIANVGD
    NCTC8325        EAENLIEQHQAENWLRNNIKDINFQLYHYAQENAEYKGMGTTCVCALVFEKSVVIANVGD
    Newman          EAENLIEQHQAENWLRNNIKDINFQLYHYAQENAEYKGMGTTCVCALVFEKSVVIANVGD
    USA300_FPR3757  EAENLIEQHQAENWLRNNIKDINFQLYHYAQENAEYKGMGTTCVCALVFEKSVVIANVGD
                    *******:****************************************************

    COL             SRAYVINSRQIEQITSDHSFVNHLVLTGQITPEEAFTHPQRNIITKVMGTDKRVSPDLFI
    N315            SRAYVINSRQIEQITSDHSFVNHLVLTGQITPEEAFTHPQRNIITKVMGTDKRVSPDLFI
    NCTC8325        SRAYVINSRQIEQITSDHSFVNHLVLTGQITPEEAFTHPQRNIITKVMGTDKRVSPDLFI
    Newman          SRAYVINSRQIEQITSDHSFVNHLVLTGQITPEEAFTHPQRNIITKVMGTDKRVSPDLFI
    USA300_FPR3757  SRAYVINSRQIEQITSDHSFVNHLVLTGQITPEEAFTHPQRNIITKVMGTDKRVSPDLFI
                    ************************************************************

    COL             KRLNFYDYLLLNSDGLTDYVKDNEIKRLLVKEGTIEDHGDQLMQLALDNHSKDNVTFILA
    N315            KRLNFYDYLLLNSDGLTDYVKDNEIKRLLVKEGTIEDHGDQLMQLALDNHSKDNVTFILA
    NCTC8325        KRLNFYDYLLLNSDGLTDYVKDNEIKRLLVKEGTIEDHGDQLMQLALDNHSKDNVTFILA
    Newman          KRLNFYDYLLLNSDGLTDYVKDNEIKRLLVKEGTIEDHGDQLMQLALDNHSKDNVTFILA
    USA300_FPR3757  KRLNFYDYLLLNSDGLTDYVKDNEIKRLLVKEGTIEDHGDQLMQLALDNHSKDNVTFILA
                    ************************************************************

    COL             AIEGDKV
    N315            AIEGDKV
    NCTC8325        AIEGDKV
    Newman          AIEGDKV
    USA300_FPR3757  AIEGDKV
                    *******