From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003503000
  • symbol?: pknB
  • description?: protein kinase

      descriptions from strain specific annotations:

    • protein kinase
    • putative protein kinase
    • Serine/threonine protein kinase PrkC, regulator of stationary phase
    • PASTA domain protein
    • pseudogene
    • serine/threonine-protein kinase
    • non-specific serine/threonine protein kinase
    • Serine/threonine-protein kinase PrkC
  • strand?: +
  • coordinates?: 3842639..3844633
  • synteny block?: BlockID0025820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1178 (prkC)
    08BA02176:
    C248_1250 (pknB)
    11819-97:
    MS7_1178 (prkC)
    71193:
    ST398NM01_1219
    ECT-R 2:
    ECTR2_1076
    ED133:
    SAOV_1223 (pknB)
    ED98:
    SAAV_1192
    HO 5096 0412:
    SAEMRSA15_10530 (pknB)
    JH1:
    SaurJH1_1304
    JH9:
    SaurJH9_1279
    JKD6008:
    SAA6008_01175 (pknB)
    JKD6159:
    SAA6159_01073 (pknB)
    LGA251:
    SARLGA251_11310 (pknB)
    M013:
    M013TW_1158
    MRSA252:
    SAR1196 (pknB)
    MSHR1132:
    SAMSHR1132_10610
    MSSA476:
    SAS1154
    Mu3:
    SAHV_1210
    Mu50:
    SAV1220
    MW2:
    MW1103
    RF122:
    SAB1084 (pknB)
    ST398:
    SAPIG1219
    T0131:
    SAT0131_01269
    TCH60:
    HMPREF0772_12012 (prkC)
    TW20:
    SATW20_12140 (pknB)
    USA300_TCH1516:
    USA300HOU_1157
    VC40:
    SAVC_05265

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MIGKIINERYKIVDKLGGGGMSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVH
    NCTC8325        MIGKIINERYKIVDKLGGGGMSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVH
    Newman          MIGKIINERYKIVDKLGGGGMSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVH
    USA300_FPR3757  MIGKIINERYKIVDKLGGGGMSTVYLAEDTILNIKVAIKAIFIPPREKEETLKRFEREVH
                    ************************************************************

    N315            NSSQLSHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESHGPLSVDTAINFTNQILDG
    NCTC8325        NSSQLSHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESHGPLSVDTAINFTNQILDG
    Newman          NSSQLSHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESHGPLSVDTAINFTNQILDG
    USA300_FPR3757  NSSQLSHQNIVSMIDVDEEDDCYYLVMEYIEGPTLSEYIESHGPLSVDTAINFTNQILDG
                    ************************************************************

    N315            IKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQ
    NCTC8325        IKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQ
    Newman          IKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQ
    USA300_FPR3757  IKHAHDMRIVHRDIKPQNILIDSNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYFSPEQ
                    ************************************************************

    N315            AKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQS
    NCTC8325        AKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQS
    Newman          AKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQS
    USA300_FPR3757  AKGEATDECTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDSVPNVTTDVRKDIPQS
                    ************************************************************

    N315            LSNVILRATEKDKANRYKTIQEMKDDLSSVLHENRANEDVYELDKMKTIAVPLKKEDLAK
    NCTC8325        LSNVILRATEKDKANRYKTIQEMKDDLSSVLHENRANEDVYELDKMKTIAVPLKKEDLAK
    Newman          LSNVILRATEKDKANRYKTIQEMKDDLSSVLHENRANEDVYELDKMKTIAVPLKKEDLAK
    USA300_FPR3757  LSNVILRATEKDKANRYKTIQEMKDDLSSVLHENRANEDVYELDKMKTIAVPLKKEDLAK
                    ************************************************************

    N315            HISEHKSNQPKRETTQVPIVNGPAHHQQFQKPEGTVYEPKPKKKSTRKIVLLSLIFSLLM
    NCTC8325        HISEHKSNQPKRETTQVPIVNGPAHHQQFQKPEGTVYEPKPKKKSTRKIVLLSLIFSLLM
    Newman          HISEHKSNQPKRETTQVPIVNGPAHHQQFQKPEGTVYEPKPKKKSTRKIVLLSLIFSLLM
    USA300_FPR3757  HISEHKSNQPKRETTQVPIVNGPAHHQQFQKPEGTVYEPKPKKKSTRKIVLLSLIFSLLM
                    ************************************************************

    N315            IALVSFVAMAMFGNKYEETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKT
    NCTC8325        IALVSFVAMAMFGNKYEETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKT
    Newman          IALVSFVAMAMFGNKYEETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKT
    USA300_FPR3757  IALVSFVAMAMFGNKYEETPDVIGKSVKEAEQIFNKNNLKLGKISRSYSDKYPENEIIKT
                    ************************************************************

    N315            TPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQA
    NCTC8325        TPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQA
    Newman          TPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQA
    USA300_FPR3757  TPNTGERVERGDSVDVVISKGPEKVKMPNVIGLPKEEALQKLKSLGLKDVTIEKVYNNQA
                    ************************************************************

    N315            PKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVES
    NCTC8325        PKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVES
    Newman          PKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVES
    USA300_FPR3757  PKGYIANQSVTANTEIAIHDSNIKLYESLGIKQVYVEDFEHKSFSKAKKALEEKGFKVES
                    ************************************************************

    N315            KEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKND
    NCTC8325        KEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKND
    Newman          KEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKND
    USA300_FPR3757  KEEYSDDIDEGDVISQSPKGKSVDEGSTISFVVSKGKKSDSSDVKTTTESVDVPYTGKND
                    ************************************************************

    N315            KSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVS
    NCTC8325        KSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVS
    Newman          KSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVS
    USA300_FPR3757  KSQKVKVYIKDKDNDGSTEKGSFDITSDQRIDIPLRIEKGKTASYIVKVDGKTVAEKEVS
                    ************************************************************

    N315            YDDI
    NCTC8325        YDDV
    Newman          YDDV
    USA300_FPR3757  YDDV
                    ***: