From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003504000
  • symbol?: rsgA
  • description?: GTPase

      descriptions from strain specific annotations:

    • GTPase
    • putative ribosome biogenesis GTPase RsgA
    • Ribosome small subunit-stimulated GTPase EngC
    • ribosome small subunit-dependent GTPase A
    • RsgA, truncated ribosome small subunit-dependent GTPase A
  • strand?: +
  • coordinates?: 3844981..3845437
  • synteny block?: BlockID0025830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1179 (engC)
    08BA02176:
    C248_1251
    11819-97:
    MS7_1179 (rsgA)
    71193:
    ST398NM01_1220
    ECT-R 2:
    ECTR2_1077 (rsgA)
    ED133:
    SAOV_1224
    ED98:
    SAAV_1193
    HO 5096 0412:
    SAEMRSA15_10540
    JH1:
    SaurJH1_1305
    JH9:
    SaurJH9_1280
    JKD6008:
    SAA6008_01176 (rsgA)
    JKD6159:
    SAA6159_01074 (rsgA)
    LGA251:
    SARLGA251_11320 (rsgA)
    M013:
    M013TW_1159
    MRSA252:
    SAR1197
    MSHR1132:
    SAMSHR1132_10620
    MSSA476:
    SAS1155
    Mu3:
    SAHV_1211
    Mu50:
    SAV1221
    MW2:
    MW1104
    RF122:
    SAB1085
    ST398:
    SAPIG1220 (rsgA)
    T0131:
    SAT0131_01270
    TCH60:
    HMPREF0772_12011 (rsgA)
    TW20:
    SATW20_12150 (rsgA)
    USA300_TCH1516:
    USA300HOU_1158 (engC)
    VC40:
    SAVC_05270 (rsgA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVF
    N315            MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVF
    NCTC8325        MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVF
    Newman          MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVF
    USA300_FPR3757  MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVF
                    ************************************************************

    COL             ERENELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARILVTKKDKTPIE
    N315            ERKNELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKTPIE
    NCTC8325        ERENELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARILVTKKDKTPIE
    Newman          ERENELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARILVTKKDKTPIE
    USA300_FPR3757  ERENELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARILVTKKDKTPIE
                    **:*********************************************:***********

    COL             KQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPE
    N315            KQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPE
    NCTC8325        KQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPE
    Newman          KQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPE
    USA300_FPR3757  KQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPE
                    ************************************************************

    COL             LNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNR
    N315            LNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNR
    NCTC8325        LNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNR
    Newman          LNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNR
    USA300_FPR3757  LNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNR
                    ************************************************************

    COL             YGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY
    N315            YGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY
    NCTC8325        YGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY
    Newman          YGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY
    USA300_FPR3757  YGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY
                    ***************************************************