From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003513000
  • symbol?: plsX
  • description?: fatty acid/phospholipid synthesis protein PlsX

      descriptions from strain specific annotations:

    • fatty acid/phospholipid synthesis protein PlsX
    • glycerol-3-phosphate acyltransferase PlsX
    • Fatty acid/phospholipid synthesis protein
    • fatty acid synthesis protein
    • putative glycerol-3-phosphate acyltransferase PlsX
    • Phosphate:acyl-ACP acyltransferase PlsX
    • putative phosphate acyltransferase
    • putative fatty acid synthesis protein
  • strand?: +
  • coordinates?: 3853485..3854492
  • synteny block?: BlockID0025920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1243 (plsX)
    N315:
    SA1072 (plsX)
    NCTC8325:
    Newman:
    NWMN_1139 (plsX)
    USA300_FPR3757:
    04-02981:
    SA2981_1187 (plsX)
    08BA02176:
    C248_1259
    11819-97:
    MS7_1187 (plsX)
    71193:
    ST398NM01_1228
    ECT-R 2:
    ECTR2_1085 (plsX)
    ED133:
    SAOV_1232
    ED98:
    SAAV_1201 (plsX)
    HO 5096 0412:
    SAEMRSA15_10620
    JH1:
    SaurJH1_1313
    JH9:
    SaurJH9_1288
    JKD6008:
    SAA6008_01184 (plsX)
    JKD6159:
    SAA6159_01082 (plsX)
    LGA251:
    SARLGA251_11400
    M013:
    M013TW_1167
    MRSA252:
    SAR1205
    MSHR1132:
    SAMSHR1132_10700
    MSSA476:
    SAS1163
    Mu3:
    SAHV_1219 (plsX)
    Mu50:
    SAV1229 (plsX)
    MW2:
    MW1112 (plsX)
    RF122:
    SAB1093
    ST398:
    SAPIG1228 (plsX)
    T0131:
    SAT0131_01279 (ureC)
    TCH60:
    HMPREF0772_12003 (plsX)
    TW20:
    SATW20_12230
    USA300_TCH1516:
    USA300HOU_1165
    VC40:
    SAVC_05310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKLAIDMMGGDNAPDIVLEAVQKAVEDFKDLEIILFGDEKKYNLNHERIEFRHCSEKIE
    N315            MVKLAIDMMGGDNAPDIVLEAVQKAVEDFKNLEIMLFGDEKKYNLNHERIEFRHCSEKIE
    NCTC8325        MVKLAIDMMGGDNAPDIVLEAVQKAVEDFKDLEIILFGDEKKYNLNHERIEFRHCSEKIE
    Newman          MVKLAIDMMGGDNAPDIVLEAVQKAVEDFKDLEIILFGDEKKYNLNHERIEFRHCSEKIE
    USA300_FPR3757  MVKLAIDMMGGDNAPDIVLEAVQKAVEDFKDLEIILFGDEKKYNLNHERIEFRHCSEKIE
                    ******************************:***:*************************

    COL             MEDEPVRAIKRKKDSSMVKMAEAVKSGEADGCVSAGNTGALMSAGLFIVGRIKGVARPAL
    N315            MEDEPVRAIKRKKDSSMVKMAEAVKSGEADGCVSAGNTGALMSVGLFIVGRIKGVARPAL
    NCTC8325        MEDEPVRAIKRKKDSSMVKMAEAVKSGEADGCVSAGNTGALMSAGLFIVGRIKGVARPAL
    Newman          MEDEPVRAIKRKKDSSMVKMAEAVKSGEADGCVSAGNTGALMSAGLFIVGRIKGVARPAL
    USA300_FPR3757  MEDEPVRAIKRKKDSSMVKMAEAVKSGEADGCVSAGNTGALMSAGLFIVGRIKGVARPAL
                    *******************************************.****************

    COL             VVTLPTIDGKGFVFLDVGANADAKPEHLLQYAQLGDIYAQKIRGIDNPKISLLNIGTEPA
    N315            VVTLPTIDGKGFVFLDVGANADAKPEHLLQYAQLGDIYAQKIRGIDNPKISLLNIGTEPA
    NCTC8325        VVTLPTIDGKGFVFLDVGANADAKPEHLLQYAQLGDIYAQKIRGIDNPKISLLNIGTEPA
    Newman          VVTLPTIDGKGFVFLDVGANADAKPEHLLQYAQLGDIYAQKIRGIDNPKISLLNIGTEPA
    USA300_FPR3757  VVTLPTIDGKGFVFLDVGANADAKPEHLLQYAQLGDIYAQKIRGIDNPKISLLNIGTEPA
                    ************************************************************

    COL             KGNSLTKKSYELLNHDHSLNFVGNIEAKTLMDGDTDVVVTDGYTGNMVLKNLEGTAKSIG
    N315            KGNSLTKKSFELLNQDHSLNFVGNIEAKTLMDGDTDVVVTDGYTGNMVLKNLEGTAKSIG
    NCTC8325        KGNSLTKKSYELLNHDHSLNFVGNIEAKTLMDGDTDVVVTDGYTGNMVLKNLEGTAKSIG
    Newman          KGNSLTKKSYELLNHDHSLNFVGNIEAKTLMDGDTDVVVTDGYTGNMVLKNLEGTAKSIG
    USA300_FPR3757  KGNSLTKKSYELLNHDHSLNFVGNIEAKTLMDGDTDVVVTDGYTGNMVLKNLEGTAKSIG
                    *********:****:*********************************************

    COL             KMLKDTIMSSTKNKLAGAILKKDLAEFAKKMDYSEYGGSVLLGLEGTVVKAHGSSNAKAF
    N315            KMLKDTIMSSTKNKLAGAILKKDLAEFAKKMDYSEYGGSVLLGLEGTVVKAHGSSNAKAF
    NCTC8325        KMLKDTIMSSTKNKLAGAILKKDLAEFAKKMDYSEYGGSVLLGLEGTVVKAHGSSNAKAF
    Newman          KMLKDTIMSSTKNKLAGAILKKDLAEFAKKMDYSEYGGSVLLGLEGTVVKAHGSSNAKAF
    USA300_FPR3757  KMLKDTIMSSTKNKLAGAILKKDLAEFAKKMDYSEYGGSVLLGLEGTVVKAHGSSNAKAF
                    ************************************************************

    COL             YSAIRQAKIAGEQNIVQTMKETVGESNE
    N315            YSAIRQAKIAGEQNIVQTMKETVGESNE
    NCTC8325        YSAIRQAKIAGEQNIVQTMKETVGESNE
    Newman          YSAIRQAKIAGEQNIVQTMKETVGESNE
    USA300_FPR3757  YSAIRQAKIAGEQNIVQTMKETVGESNE
                    ****************************