From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003527000
  • symbol?: rpsP
  • description?: 30S ribosomal protein S16
  • strand?: +
  • coordinates?: 3867299..3867574
  • synteny block?: BlockID0026050
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1254 (rpsP)
    N315:
    SA1081 (rpsP)
    NCTC8325:
    Newman:
    NWMN_1148 (rpsP)
    USA300_FPR3757:
    04-02981:
    SA2981_1196 (rpsP)
    08BA02176:
    C248_1269 (rpsP)
    11819-97:
    MS7_1196 (rpsP)
    71193:
    ST398NM01_1238
    ECT-R 2:
    ECTR2_1094 (rpsP)
    ED133:
    SAOV_1241 (rpsP)
    ED98:
    SAAV_1211 (rpsP)
    HO 5096 0412:
    SAEMRSA15_10710 (rpsP)
    JH1:
    SaurJH1_1322 (rpsP)
    JH9:
    SaurJH9_1297 (rpsP)
    JKD6008:
    SAA6008_01193 (rpsP)
    JKD6159:
    SAA6159_01091 (rpsP)
    LGA251:
    SARLGA251_11490 (rpsP)
    M013:
    M013TW_1176
    MRSA252:
    SAR1214 (rpsP)
    MSHR1132:
    SAMSHR1132_10810
    MSSA476:
    SAS1172 (rpsP)
    Mu3:
    SAHV_1228 (rpsP)
    Mu50:
    SAV1238 (rpsP)
    MW2:
    MW1121 (rpsP)
    RF122:
    SAB1102 (rpsP)
    ST398:
    SAPIG1238 (rpsP)
    T0131:
    SAT0131_01288
    TCH60:
    HMPREF0772_11993 (rpsP)
    TW20:
    SATW20_12320 (rpsP)
    USA300_TCH1516:
    VC40:
    SAVC_05355 (rpsP)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKW
    N315            MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKW
    NCTC8325        MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKW
    Newman          MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKW
    USA300_FPR3757  MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKW
                    ************************************************************

    COL             LNDGAKPTDTVHNILSKEGIMKKFDEQKKAK
    N315            LNDGAKPTDTVHNILSKEGIMKKFDEQKKAK
    NCTC8325        LNDGAKPTDTVHNILSKEGIMKKFDEQKKAK
    Newman          LNDGAKPTDTVHNILSKEGIMKKFDEQKKAK
    USA300_FPR3757  LNDGAKPTDTVHNILSKEGIMKKFDEQKKAK
                    *******************************