From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003528000
  • symbol?: rimM
  • description?: 16S rRNA-processing protein RimM

      descriptions from strain specific annotations:

    • 16S rRNA-processing protein RimM
    • 16S rRNA processing protein
    • Ribosome maturation factor rimM
  • strand?: +
  • coordinates?: 3867764..3868267
  • synteny block?: BlockID0026060
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1255 (rimM)
    N315:
    SA1082 (rimM)
    NCTC8325:
    Newman:
    NWMN_1149 (rimM)
    USA300_FPR3757:
    04-02981:
    SA2981_1197 (rimM)
    08BA02176:
    C248_1270 (rimM)
    11819-97:
    MS7_1197 (rimM)
    71193:
    ST398NM01_1239
    ECT-R 2:
    ECTR2_1095 (rimM)
    ED133:
    SAOV_1242 (rimM)
    ED98:
    SAAV_1212 (rimM)
    HO 5096 0412:
    SAEMRSA15_10720 (rimM)
    JH1:
    SaurJH1_1323 (rimM)
    JH9:
    SaurJH9_1298 (rimM)
    JKD6008:
    SAA6008_01194 (rimM)
    JKD6159:
    SAA6159_01092 (rimM)
    LGA251:
    SARLGA251_11500 (rimM)
    M013:
    M013TW_1177
    MRSA252:
    SAR1215 (rimM)
    MSHR1132:
    SAMSHR1132_10820
    MSSA476:
    SAS1173 (rimM)
    Mu3:
    SAHV_1229 (rimM)
    Mu50:
    SAV1239 (rimM)
    MW2:
    MW1122 (rimM)
    RF122:
    SAB1103 (rimM)
    ST398:
    SAPIG1239 (rimM)
    T0131:
    SAT0131_01289 (nhaC)
    TCH60:
    HMPREF0772_11992 (rimM)
    TW20:
    SATW20_12330 (rimM)
    USA300_TCH1516:
    VC40:
    SAVC_05360 (rimM)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRVEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLH
    N315            MRVEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLH
    NCTC8325        MRVEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLH
    Newman          MRVEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLH
    USA300_FPR3757  MRVEVGQIVNTHGIKGEIKVKSNSDFTDVRFQPGQVLTVVHNNNDLEYTVKSHRVHKGLH
                    ************************************************************

    COL             MLTFEGINNINDIEHLKGSSIYQERDHEDIVLEENEFYYSDIIGCTVFDDQETPIGRVIN
    N315            MLTFEGINNINDIEHLKGSSIYQERDHEDIVLEENEFYYSDIIGCTVFDDQETPIGRVIN
    NCTC8325        MLTFEGINNINDIEHLKGSSIYQERDHEDIVLEENEFYYSDIIGCTVFDDQETPIGRVIN
    Newman          MLTFEGINNINDIEHLKGSSIYQERDHEDIVLEENEFYYSDIIGCTVFDDQETPIGRVIN
    USA300_FPR3757  MLTFEGINNINDIEHLKGSSIYQERDHEDIVLEENEFYYSDIIGCTVFDDQETPIGRVIN
                    ************************************************************

    COL             IFETGANDVWVIKGSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD
    N315            IFETGANDVWVIKGSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD
    NCTC8325        IFETGANDVWVIKGSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD
    Newman          IFETGANDVWVIKGSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD
    USA300_FPR3757  IFETGANDVWVIKGSKEYLIPYIADVVKEVDVENKKIIITPMEGLLD
                    ***********************************************