From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003537000
  • symbol?: sucC
  • description?: succinyl-CoA synthetase subunit beta

      descriptions from strain specific annotations:

    • succinyl-CoA synthetase subunit beta
    • succinyl-CoA ligase subunit beta
    • putative CoA synthetase protein
    • succinate--CoA ligase (ADP-forming) beta subunit
    • Succinyl-CoA ligase [ADP-forming] beta chain
    • Succinyl-CoA ligase [ADP-forming] subunit beta
    • Succinyl-CoA ligase beta chain
    • succinyl-CoA synthase subunit beta
    • succinyl-CoA synthetase beta chain (SCS-alpha)(Vegetative protein 63) (VEG63)
  • strand?: +
  • coordinates?: 3876383..3877549
  • synteny block?: BlockID0026140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1262 (sucC)
    N315:
    SA1088 (sucC)
    NCTC8325:
    Newman:
    NWMN_1155 (sucC)
    USA300_FPR3757:
    04-02981:
    SA2981_1203 (sucC)
    08BA02176:
    C248_1276
    11819-97:
    MS7_1203 (sucC)
    71193:
    ST398NM01_1245
    ECT-R 2:
    ECTR2_1101 (sucC)
    ED133:
    SAOV_1248
    ED98:
    SAAV_1219 (sucC)
    HO 5096 0412:
    SAEMRSA15_10780
    JH1:
    SaurJH1_1329 (sucC)
    JH9:
    SaurJH9_1304 (sucC)
    JKD6008:
    SAA6008_01200 (sucC)
    JKD6159:
    SAA6159_01100 (sucC)
    LGA251:
    SARLGA251_11560
    M013:
    M013TW_1183
    MRSA252:
    SAR1221 (sucC)
    MSHR1132:
    SAMSHR1132_10880
    MSSA476:
    SAS1179 (sucC)
    Mu3:
    SAHV_1235 (sucC)
    Mu50:
    SAV1245 (sucC)
    MW2:
    MW1128 (sucC)
    RF122:
    SAB1109 (sucC)
    ST398:
    SAPIG1245
    T0131:
    SAT0131_01295
    TCH60:
    HMPREF0772_11986 (sucC)
    TW20:
    SATW20_12390
    USA300_TCH1516:
    USA300HOU_1176 (sucC)
    VC40:
    SAVC_05390 (sucC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
    N315            MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
    NCTC8325        MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
    Newman          MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
    USA300_FPR3757  MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
                    ************************************************************

    COL             KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQ
    N315            KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQ
    NCTC8325        KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQ
    Newman          KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQ
    USA300_FPR3757  KIAKSLSEVETYAKELLGKTLVTHQTGPEGKEIKRLYIEEGCAIQKEYYVGFVIDRATDQ
                    ************************************************************

    COL             VTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKF
    N315            VTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKF
    NCTC8325        VTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKF
    Newman          VTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKF
    USA300_FPR3757  VTLMASEEGGTEIEEVAAKTPEKIFKETIDPVIGLSPFQARRIAFNINIPKESVNKAAKF
                    ************************************************************

    COL             LLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHKDVVELRDLEEEDP
    N315            LLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHKDVVELRDLEEEDP
    NCTC8325        LLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHKDVVELRDLEEEDP
    Newman          LLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHKDVVELRDLEEEDP
    USA300_FPR3757  LLALYNVFIEKDCSIVEINPLVTTADGDVLALDAKINFDDNALFRHKDVVELRDLEEEDP
                    ************************************************************

    COL             KEIEASKHDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDAGGSATREKVTE
    N315            KEIEASKHDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDAGGSATREKVTE
    NCTC8325        KEIEASKHDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDAGGSATREKVTE
    Newman          KEIEASKHDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDAGGSATREKVTE
    USA300_FPR3757  KEIEASKHDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDAGGSATREKVTE
                    ************************************************************

    COL             AFKIILGDENVKGIFVNIFGGIMKCDVIAEGIVEAVKEVDLTLPLVVRLEGTNVELGKKI
    N315            AFKIILGDENVKGIFVNIFGGIMKCDVIAEGIVEAVKEVDLTLPLVVRLEGTNVELGKKI
    NCTC8325        AFKIILGDENVKGIFVNIFGGIMKCDVIAEGIVEAVKEVDLTLPLVVRLEGTNVELGKKI
    Newman          AFKIILGDENVKGIFVNIFGGIMKCDVIAEGIVEAVKEVDLTLPLVVRLEGTNVELGKKI
    USA300_FPR3757  AFKIILGDENVKGIFVNIFGGIMKCDVIAEGIVEAVKEVDLTLPLVVRLEGTNVELGKKI
                    ************************************************************

    COL             LKDSGLAIEPAATMAEGAQKIVKLVKEA
    N315            LKDSGLAIEPAATMAEGAQKIVKLVKEA
    NCTC8325        LKDSGLAIEPAATMAEGAQKIVKLVKEA
    Newman          LKDSGLAIEPAATMAEGAQKIVKLVKEA
    USA300_FPR3757  LKDSGLAIEPAATMAEGAQKIVKLVKEA
                    ****************************