From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003539000
  • symbol?: lytN
  • description?: cell wall hydrolase

      descriptions from strain specific annotations:

    • cell wall hydrolase
    • LytN protein
    • cell-wall hydrolase lytN
    • Putative cell wall hydrolase
    • C51 family D-Ala-D-Gly carboxypeptidase
    • CHAP domain-containing protein
    • pseudogene
  • strand?: +
  • coordinates?: 3878675..3879830
  • synteny block?: BlockID0026160
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1264 (lytN)
    N315:
    SA1090 (lytN)
    NCTC8325:
    Newman:
    NWMN_1157 (lytN)
    USA300_FPR3757:
    04-02981:
    SA2981_1205 (lytN)
    08BA02176:
    11819-97:
    MS7_1205
    71193:
    ECT-R 2:
    ECTR2_1103
    ED133:
    ED98:
    SAAV_1221 (lytN)
    HO 5096 0412:
    SAEMRSA15_10800 (lytN)
    JH1:
    SaurJH1_1331
    JH9:
    SaurJH9_1306
    JKD6008:
    SAA6008_01202 (lytN)
    JKD6159:
    SAA6159_01102 (lytN)
    LGA251:
    M013:
    MRSA252:
    SAR1223 (lytN)
    MSHR1132:
    SAMSHR1132_10900
    MSSA476:
    SAS1181
    Mu3:
    SAHV_1237 (lytN)
    Mu50:
    SAV1247 (lytN)
    MW2:
    MW1130 (lytN)
    RF122:
    ST398:
    T0131:
    SAT0131_01297
    TCH60:
    HMPREF0772_11984 (lytN)
    TW20:
    SATW20_12410 (lytN)
    USA300_TCH1516:
    USA300HOU_1178 (lytN)
    VC40:
    SAVC_05400

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFLYYCKECFIMNKQQSKVRYSIRKVSIGILSISIGMFLALGMSNKAYADEIDKSKDFTR
    N315            -----------MNKQQSKVRYSIRKVSIGILSISIGMFLALGMSNKAYADEIDKSKDFTR
    NCTC8325        -----------MNKQQSKVRYSIRKVSIGILSISIGMFLALGMSNKAYADEIDKSKDFTR
    Newman          MFLYYCKECFIMNKQQSKVRYSIRKVSIGILSISIGMFLALGMSNKAYADEIDKSKDFTR
    USA300_FPR3757  MFVYYCKECFIMNKQQSKVRYSIRKVSIGILSISIGMFLALGMSNKAYADEIDKSKDFTR
                               *************************************************

    COL             GYEQNVFAKSELNANKNTTKDKIKNEGAVKTSDTSLKLDNKSAISNGNEINQDIKISNTP
    N315            GYEQNVFAKSELNANKNTTKDKIKNEGAVKTSDTSLKLDNKSAISNGNEINQDIKISNTP
    NCTC8325        GYEQNVFAKSELNANKNTTKDKIKNEGAVKTSDTSLKLDNKSAISNGNEINQDIKISNTP
    Newman          GYEQNVFAKSELNANKNTTKDKIKNEGAVKTSDTSLKLDNKSAISNGNEINQDIKISNTP
    USA300_FPR3757  GYEQNVFAKSELNANKNTTKDKIKNEGAVKTSDTSLKLDNKSAISNGNEINQDIKISNTP
                    ************************************************************

    COL             KNSSQGNNLVINNNELTKEIKIANLEAQNSNQKKTNKVTNNYFGYYSFREAPKTQIYTVK
    N315            KNSSQGNNLVINNNEPTKEIKIANLEAQNSNQKKTNKVTNNYFGYYSFREAPKTQIYTVK
    NCTC8325        KNSSQGNNLVINNNELTKEIKIANLEAQNSNQKKTNKVTNNYFGYYSFREAPKTQIYTVK
    Newman          KNSSQGNNLVINNNELTKEIKIANLEAQNSNQKKTNKVTNNYFGYYSFREAPKTQIYTVK
    USA300_FPR3757  KNSSQGNNLVINNNELTKEIKIANLEAQNSNQKKTNKVTNNYFGYYSFREAPKTQIYTVK
                    *************** ********************************************

    COL             KGDTLSAIALKYKTTVSNIQNTNNIANPNLIFIGQKLKVPMTPLVEPKPKTVSSNNKSNS
    N315            KGDTLSAIALKYKTTVSNIQNTNNIANPNLIFIGQKLKVPMTPLVEPKPKTVSSNNKSNS
    NCTC8325        KGDTLSAIALKYKTTVSNIQNTNNIANPNLIFIGQKLKVPMTPLVEPKPKTVSSNNKSNS
    Newman          KGDTLSAIALKYKTTVSNIQNTNNIANPNLIFIGQKLKVPMTPLVEPKPKTVSSNNKSNS
    USA300_FPR3757  KGDTLSAIALKYKTTVSNIQNTNNIANPNLIFIGQKLKVPMTPLVEPKPKTVSSNNKSNS
                    ************************************************************

    COL             NSSTLNYLKTLENRGWDFDGSYGWQCFDLVNVYWNHLYGHGLKGYGAKDIPYANNFNSEA
    N315            NSSTLNYLKTLENRGWDFDGSYGWQCFDLVNVYWNHLYGHGLKGYGAKDIPYANNFNSEA
    NCTC8325        NSSTLNYLKTLENRGWDFDGSYGWQCFDLVNVYWNHLYGHGLKGYGAKDIPYANNFNSEA
    Newman          NSSTLNYLKTLENRGWDFDGSYGWQCFDLVNVYWNHLYGHGLKGYGAKDIPYANNFNSEA
    USA300_FPR3757  NSSTLNYLKTLENRGWDFDGSYGWQCFDLVNVYWNHLYGHGLKGYGAKDIPYANNFNSEA
                    ************************************************************

    COL             KIYHNTPTFKAEPGDLVVFSGRFGGGYGHTAIVLNGDYDGKLMKFQSLDQNWNNGGWRKA
    N315            KIYHNTPTFKAEPGDLVVFSGRFGGGYGHTAIVLNGDYDGKLMKFQSLDQNWNNGGWRKA
    NCTC8325        KIYHNTPTFKAEPGDLVVFSGRFGGGYGHTAIVLNGDYDGKLMKFQSLDQNWNNGGWRKA
    Newman          KIYHNTPTFKAEPGDLVVFSGRFGGGYGHTAIVLNGDYDGKLMKFQSLDQNWNNGGWRKA
    USA300_FPR3757  KIYHNTPTFKAEPGDLVVFSGRFGGGYGHTAIVLNGDYDGKLMKFQSLDQNWNNGGWRKA
                    ************************************************************

    COL             EVAHKVVHNYENDMIFIRPFKKA
    N315            EVAHKVVHNYENDMIFIRPFKKA
    NCTC8325        EVAHKVVHNYENDMIFIRPFKKA
    Newman          EVAHKVVHNYENDMIFIRPFKKA
    USA300_FPR3757  EVAHKVVHNYENDMIFIRPFKKA
                    ***********************