From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003551000
  • symbol?: clpQ
  • description?: ATP-dependent protease peptidase subunit

      descriptions from strain specific annotations:

    • ATP-dependent protease peptidase subunit
    • HslU--HslV peptidase proteolytic subunit
    • ATP-dependent protease HslV
    • ATP-dependent endopeptidase hsl proteolytic subunit
    • ATP-dependent protease heat shock protein
    • ATP-dependent protease HslVU, peptidase subunit
    • ATP-dependent protease subunit HslV
    • putative ATP-dependent protease
    • T01 family HslV component of HsIUV peptidase
  • strand?: +
  • coordinates?: 3887821..3888366
  • synteny block?: BlockID0026280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1270 (hslV)
    N315:
    SA1096 (clpQ)
    NCTC8325:
    Newman:
    NWMN_1163 (hslV)
    USA300_FPR3757:
    04-02981:
    SA2981_1211 (clpQ)
    08BA02176:
    C248_1284 (hslV)
    11819-97:
    MS7_1211 (hslV)
    71193:
    ST398NM01_1255
    ECT-R 2:
    ECTR2_1109
    ED133:
    SAOV_1255
    ED98:
    SAAV_1227 (hslV)
    HO 5096 0412:
    SAEMRSA15_10860 (hslV)
    JH1:
    SaurJH1_1338
    JH9:
    SaurJH9_1313
    JKD6008:
    SAA6008_01208 (clpQ)
    JKD6159:
    SAA6159_01108 (clpQ)
    LGA251:
    SARLGA251_11640 (hslV)
    M013:
    M013TW_1193
    MRSA252:
    SAR1229 (hslV)
    MSHR1132:
    SAMSHR1132_10960
    MSSA476:
    SAS1187
    Mu3:
    SAHV_1243 (clpQ)
    Mu50:
    SAV1253 (clpQ)
    MW2:
    MW1136 (clpQ)
    RF122:
    SAB1115 (hslV)
    ST398:
    SAPIG1255
    T0131:
    SAT0131_01304
    TCH60:
    HMPREF0772_11977 (hslV)
    TW20:
    SATW20_12470 (hslV)
    USA300_TCH1516:
    USA300HOU_1184 (clpQ)
    VC40:
    SAVC_05430

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNTTLHATTIYAVRHNGKAAMAGDGQVTLGQQVIMKQTARKVRRLYEGKVLAGFAGSVA
    N315            MSNTTLHATTIYAVRHNGKAAMAGDGQVTLGQQVIMKQTARKVRRLYEGKVLAGFAGSVA
    NCTC8325        MSNTTLHATTIYAVRHNGKAAMAGDGQVTLGQQVIMKQTARKVRRLYEGKVLAGFAGSVA
    Newman          MSNTTLHATTIYAVRHNGKAAMAGDGQVTLGQQVIMKQTARKVRRLYEGKVLAGFAGSVA
    USA300_FPR3757  MSNTTLHATTIYAVRHNGKAAMAGDGQVTLGQQVIMKQTARKVRRLYEGKVLAGFAGSVA
                    ************************************************************

    COL             DAFTLFEKFETKLQQFSGNLERAAVELAQEWRGDKQLRQLEAMLIVMDKDAILVVSGTGE
    N315            DAFTLFEKFETKLQQFSGNLERAAVELAQEWRGDKQLRQLEAMLIVMDKDAILVVSGTGE
    NCTC8325        DAFTLFEKFETKLQQFSGNLERAAVELAQEWRGDKQLRQLEAMLIVMDKDAILVVSGTGE
    Newman          DAFTLFEKFETKLQQFSGNLERAAVELAQEWRGDKQLRQLEAMLIVMDKDAILVVSGTGE
    USA300_FPR3757  DAFTLFEKFETKLQQFSGNLERAAVELAQEWRGDKQLRQLEAMLIVMDKDAILVVSGTGE
                    ************************************************************

    COL             VIAPDDDLIAIGSGGNYALSAGRALKRHASHLSAEEMAYESLKVAADICVFTNDNIVVET
    N315            VIAPDDDLIAIGSGGNYALSAGRALKRHASHLSAEEMAYESLKVAADICVFTNDNIVVET
    NCTC8325        VIAPDDDLIAIGSGGNYALSAGRALKRHASHLSAEEMAYESLKVAADICVFTNDNIVVET
    Newman          VIAPDDDLIAIGSGGNYALSAGRALKRHASHLSAEEMAYESLKVAADICVFTNDNIVVET
    USA300_FPR3757  VIAPDDDLIAIGSGGNYALSAGRALKRHASHLSAEEMAYESLKVAADICVFTNDNIVVET
                    ************************************************************

    COL             L
    N315            L
    NCTC8325        L
    Newman          L
    USA300_FPR3757  L
                    *