From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003558000
  • symbol?: pyrH
  • description?: uridylate kinase

      descriptions from strain specific annotations:

    • uridylate kinase
    • UMP kinase
    • putative uridylate kinase
  • strand?: +
  • coordinates?: 3892903..3893679
  • synteny block?: BlockID0026350
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1277 (pyrH)
    N315:
    SA1101 (pyrH)
    NCTC8325:
    Newman:
    NWMN_1168 (pyrH)
    USA300_FPR3757:
    04-02981:
    SA2981_1216 (smbA)
    08BA02176:
    C248_1291 (pyrH)
    11819-97:
    MS7_1216 (pyrH)
    71193:
    ST398NM01_1260
    ECT-R 2:
    ECTR2_1114 (pyrH)
    ED133:
    SAOV_1260
    ED98:
    SAAV_1233 (pyrH)
    HO 5096 0412:
    SAEMRSA15_10910 (pyrH)
    JH1:
    SaurJH1_1344 (pyrH)
    JH9:
    SaurJH9_1318 (pyrH)
    JKD6008:
    SAA6008_01213 (smbA)
    JKD6159:
    SAA6159_01113 (smbA)
    LGA251:
    SARLGA251_11690 (pyrH)
    M013:
    M013TW_1198
    MRSA252:
    SAR1234 (pyrH)
    MSHR1132:
    SAMSHR1132_11010
    MSSA476:
    SAS1192 (pyrH)
    Mu3:
    SAHV_1248 (pyrH)
    Mu50:
    SAV1258 (pyrH)
    MW2:
    MW1141 (pyrH)
    RF122:
    SAB1120 (pyrH)
    ST398:
    SAPIG1260 (pyrH)
    T0131:
    SAT0131_01311
    TCH60:
    HMPREF0772_11972 (pyrH)
    TW20:
    SATW20_12520 (pyrH)
    USA300_TCH1516:
    USA300HOU_1191 (pyrH)
    VC40:
    SAVC_05455 (pyrH)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------------MAQISKYKRVVLKLSGEALAGEKGFGINPVIIKSVAEQVAEV
    N315            ------------------MAQISKYKRVVLKLSGEALAGEKGFGINPVIIKSVAEQVAEV
    NCTC8325        ------------------MAQISKYKRVVLKLSGEALAGEKGFGINPVIIKSVAEQVAEV
    Newman          MSSLLVYVTYIHDREDKKMAQISKYKRVVLKLSGEALAGEKGFGINPVIIKSVAEQVAEV
    USA300_FPR3757  ------------------MAQISKYKRVVLKLSGEALAGEKGFGINPVIIKSVAEQVAEV
                                      ******************************************

    COL             AKMDCEIAVIVGGGNIWRGKTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRV
    N315            AKMDCEIAVIVGGGNIWRGKTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRV
    NCTC8325        AKMDCEIAVIVGGGNIWRGKTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRV
    Newman          AKMDCEIAVIVGGGNIWRGKTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRV
    USA300_FPR3757  AKMDCEIAVIVGGGNIWRGKTGSDLGMDRGTADYMGMLATVMNALALQDSLEQLDCDTRV
                    ************************************************************

    COL             LTSIEMKQVAEPYIRRRAIRHLEKKRVVIFAAGIGNPYFSTDTTAALRAAEVEADVILMG
    N315            LTSIEMKQVAEPYIRRRAIRHLEKKRVVIFAAGIGNPYFSTDTTAALRAAEVEADVILMG
    NCTC8325        LTSIEMKQVAEPYIRRRAIRHLEKKRVVIFAAGIGNPYFSTDTTAALRAAEVEADVILMG
    Newman          LTSIEMKQVAEPYIRRRAIRHLEKKRIVIFAAGIGNPYFSTDTTAALRAAEVEADVILMG
    USA300_FPR3757  LTSIEMKQVAEPYIRRRAIRHLEKKRVVIFAAGIGNPYFSTDTTAALRAAEVEADVILMG
                    **************************:*********************************

    COL             KNNVDGVYSADPKVNKDAVKYEHLTHIQMLQEGLQVMDSTASSFCMDNNIPLTVFSIMEE
    N315            KNNVDGVYSADPKVNKDAVKYEHLTHIQMLQEGLQVMDSTASSFCMDNNIPLTVFSIMEE
    NCTC8325        KNNVDGVYSADPKVNKDAVKYEHLTHIQMLQEGLQVMDSTASSFCMDNNIPLTVFSIMEE
    Newman          KNNVDGVYSADPKVNKDAVKYEHLTHIQMLQEGLQVMDSTASSFCMDNNIPLTVFSIMEE
    USA300_FPR3757  KNNVDGVYSADPKVNKDAVKYEHLTHIQMLQEGLQVMDSTASSFCMDNNIPLTVFSIMEE
                    ************************************************************

    COL             GNIKRAVMGEKIGTLITK
    N315            GNIKRAVMGEKIGTLITK
    NCTC8325        GNIKRAVMGEKIGTLITK
    Newman          GNIKRAVMGEKIGTLITK
    USA300_FPR3757  GNIKRAVMGEKIGTLITK
                    ******************