From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003571000
  • symbol?: rbfA
  • description?: ribosome-binding factor A

      descriptions from strain specific annotations:

    • ribosome-binding factor A
    • putative ribosome-binding factor A
    • ribosome-binding factor A (P15B PROTEIN)
  • strand?: +
  • coordinates?: 3909175..3909567
  • synteny block?: BlockID0026480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1289 (rbfA)
    N315:
    SA1113 (rbfA)
    NCTC8325:
    Newman:
    NWMN_1179 (rbfA)
    USA300_FPR3757:
    04-02981:
    SA2981_1228 (rbfA)
    08BA02176:
    C248_1303 (rbfA)
    11819-97:
    MS7_1228 (rbfA)
    71193:
    ST398NM01_1272
    ECT-R 2:
    ECTR2_1126 (rbfA)
    ED133:
    SAOV_1272 (rbfA)
    ED98:
    SAAV_1245 (rbfA)
    HO 5096 0412:
    SAEMRSA15_11030 (rbfA)
    JH1:
    SaurJH1_1356 (rbfA)
    JH9:
    SaurJH9_1330 (rbfA)
    JKD6008:
    SAA6008_01225 (rbfA)
    JKD6159:
    SAA6159_01125 (rbfA)
    LGA251:
    SARLGA251_11810 (rbfA)
    M013:
    M013TW_1210
    MRSA252:
    SAR1246 (rbfA)
    MSHR1132:
    SAMSHR1132_11130
    MSSA476:
    SAS1204 (rbfA)
    Mu3:
    SAHV_1260 (rbfA)
    Mu50:
    SAV1270 (rbfA)
    MW2:
    MW1153 (rbfA)
    RF122:
    SAB1132 (rbfA)
    ST398:
    SAPIG1272 (rbfA)
    T0131:
    SAT0131_01324
    TCH60:
    HMPREF0772_11959 (rbfA)
    TW20:
    SATW20_12640 (rbfA)
    USA300_TCH1516:
    USA300HOU_1202 (rbfA)
    VC40:
    SAVC_05515 (rbfA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------MSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQ
    N315            --------------MSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQ
    NCTC8325        --------------MSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQ
    Newman          MQITIELKDKEVTRMSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQ
    USA300_FPR3757  --------------MSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQ
                                  **********************************************

    COL             AKVFLTVLGNDKEVENTFKALDKAKGFIKSELGSRMRLRIMPELMYEYDQSIEYGNKIER
    N315            AKVFLTVLGNDKEVENTFKALDKAKGFIKSELGSRMRLRIMPELMYEYDQSIEYGNKIER
    NCTC8325        AKVFLTVLGNDKEVENTFKALDKAKGFIKSELGSRMRLRIMPELMYEYDQSIEYGNKIER
    Newman          AKVFLTVLGNDKEVENTFKALDKAKGFIKSELGSRMRLRIMPELMYEYDQSIEYGNKIER
    USA300_FPR3757  AKVFLTVLGNDKEVENTFKALDKAKGFIKSELGSRMRLRIMPELMYEYDQSIEYGNKIER
                    ************************************************************

    COL             MIQDLHKQDR
    N315            MIQDLHKQDR
    NCTC8325        MIQDLHKQDR
    Newman          MIQDLHKQDR
    USA300_FPR3757  MIQDLHKQDR
                    **********