From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003577000
  • symbol?: ftsK
  • description?: DNA translocase FtsK

      descriptions from strain specific annotations:

    • DNA translocase FtsK
    • FtsK/SpoIIIE family protein
    • DNA translocase FtsK/SpoIIIE family protein
    • cell division protein FtsK
    • DNA translocase ftsK (DNA translocase SpoIIIE)
    • cell division protein FtsK/SpoIIIE
    • FtsK/SpoIIIE family DNA translocase
    • putative DNA translocase (FtsK/SpoIIIE family protein)
    • SpoIII family DNA translocase
    • sporulation-related protein SpoIIIE homologue
    • sporulation-related protein SpoIIIE-like protein
  • strand?: +
  • coordinates?: 3916689..3919070
  • synteny block?: BlockID0026540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1119 (spoIIIE)
    NCTC8325:
    Newman:
    NWMN_1185 (ftsK)
    USA300_FPR3757:
    04-02981:
    SA2981_1234 (ftsK)
    08BA02176:
    C248_1309
    11819-97:
    MS7_1234 (ftsK)
    71193:
    ST398NM01_1278
    ECT-R 2:
    ECTR2_1132
    ED133:
    SAOV_1278
    ED98:
    SAAV_1251
    HO 5096 0412:
    SAEMRSA15_11090
    JH1:
    SaurJH1_1362
    JH9:
    SaurJH9_1336
    JKD6008:
    SAA6008_01231 (ftsK)
    JKD6159:
    SAA6159_01131 (ftsK)
    LGA251:
    SARLGA251_11870
    M013:
    M013TW_1216
    MRSA252:
    SAR1252
    MSHR1132:
    SAMSHR1132_11190
    MSSA476:
    SAS1210
    Mu3:
    SAHV_1266 (spoIIIE)
    Mu50:
    SAV1276 (spoIIIE)
    MW2:
    MW1159 (spoIIIE)
    RF122:
    SAB1138
    ST398:
    SAPIG1278
    T0131:
    SAT0131_01331 (fosB)
    TCH60:
    HMPREF0772_11953
    TW20:
    SATW20_12700
    USA300_TCH1516:
    USA300HOU_1208
    VC40:
    SAVC_05545

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRQLAQAKKKSTAKKKTTSKKRTNSRKKKNDNPIRYVIAILVVVLMVLGVFQLGIIGRLI
    N315            ---MAQAKKKSTAKKKTASKKRTNSRKKKNDNPIRYVIAILVVVLMVLGVFQLGIIGRLI
    NCTC8325        ---------------------------------------------MVLGVFQLGIIGRLI
    Newman          ---MAQAKKKSTAKKKTTSKKRTNSRKKKNDNPIRYVIAILVVVLMVLGVFQLGIIGRLI
    USA300_FPR3757  ---------------------------------------------MVLGVFQLGIIGRLI
                                                                 ***************

    COL             DSFFNYLFGYSRYLTYILVLLATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNS
    N315            DSFFNYLFGYSRYLTYILVLLATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNS
    NCTC8325        DSFFNYLFGYSRYLTYILVLLATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNS
    Newman          DSFFNYLFGYSRYLTYILVLLATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNS
    USA300_FPR3757  DSFFNYLFGYSRYLTYILVLLATGFITYSKRIPKTRRTAGSIVLQIALLFVSQLVFHFNS
                    ************************************************************

    COL             GIKAEREPVLSYVYQSYQHSHFPNFGGGVLGFYLLELSVPLISLFGVCIITILLLCSSVI
    N315            GIKAEREPVLSYVYQSYQHSHFPNFGGGVLGFYLLELSVPLISLFGVCIITILLLCSSVI
    NCTC8325        GIKAEREPVLSYVYQSYQHSHFPNFGGGVLGFYLLELSVPLISLFGVCIITILLLCSSVI
    Newman          GIKAEREPVLSYVYQSYQHSHFPNFGGGVLGFYLLELSVPLISLFGVCIITILLLCSSVI
    USA300_FPR3757  GIKAEREPVLSYVYQSYQHSHFPNFGGGVLGFYLLELSVPLISLFGVCIITILLLCSSVI
                    ************************************************************

    COL             LLTNHQHREVAKVALENIKAWFGSFNEKMSERNQEKQLKREEKARLKEEQKARQNEQPQI
    N315            LLTNHQHRDVAKVALENIKAWFGSFNEKMSERNQEKQLKREEKARLKEEQKARQNEQPQI
    NCTC8325        LLTNHQHREVAKVALENIKAWFGSFNEKMSERNQEKQLKREEKARLKEEQKARQNEQPQI
    Newman          LLTNHQHREVAKVALENIKAWFGSFNEKMSERNQEKQLKREEKARLKEEQKARQNEQPQI
    USA300_FPR3757  LLTNHQHREVAKVALENIKAWFGSFNEKMSERNQEKQLKREEKAKLKEEQKARQNEQPQI
                    ********:***********************************:***************

    COL             KDVSDFTEVPQERDIPIYGHTENESKSQSQPSRKKRVFDAENSSNNIVNHHQADQQEQLT
    N315            KDVSDFTEVPQERDIPIYGHTENESKSQCQPSRKKRVFDAENSSNNIVN-HQADQQEQLT
    NCTC8325        KDVSDFTEVPQERDIPIYGHTENESKSQSQPSRKKRVFDAENSSNNIVNHHQADQQEQLT
    Newman          KDVSDFTEVPQERDIPIYGHTENESKSQSQPSRKKRVFDAENSSNNIVNHHQADQQEQLT
    USA300_FPR3757  KDVSDFTEVPQERDIPIYGHTENESKSQSQPSRKKRVFDAENSSNNIVNHHQADQQEQLT
                    ****************************.******************** **********

    COL             EQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVLENTLKDF
    N315            EQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVLENTLKDF
    NCTC8325        EQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVLENTLKDF
    Newman          EQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVLENTLKDF
    USA300_FPR3757  EQTHNSVESENTIEEAGEVTNVSYVVPPLTLLNQPAKQKATSKAEVQRKGQVLENTLKDF
                    ************************************************************

    COL             GVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVG
    N315            GVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVG
    NCTC8325        GVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVG
    Newman          GVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVG
    USA300_FPR3757  GVNAKVTQIKIGPAVTQYEIQPAQGVKVSKIVNLHNDIALALAAKDVRIEAPIPGRSAVG
                    ************************************************************

    COL             IEVPNEKISLVSLKEVLDEKFPSNNKLEVGLGRDISGDPITVPLNEMPHLLVAGSTGSGK
    N315            IEVPNEKISLVSLKEVLDEKFPSNNKLEVGLGRDISGDPITVPLNEMPHLLVAGSTGSGK
    NCTC8325        IEVPNEKISLVSLKEVLDEKFPSNNKLEVGLGRDISGDPITVPLNEMPHLLVAGSTGSGK
    Newman          IEVPNEKISLVSLKEVLDEKFPSNNKLEVGLGRDISGDPITVPLNEMPHLLVAGSTGSGK
    USA300_FPR3757  IEVPNEKISLVSLKEVLDEKFPSNNKLEVGLGRDISGDPITVPLNEMPHLLVAGSTGSGK
                    ************************************************************

    COL             SVCINGIITSILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIV
    N315            SVCINGIITSILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIV
    NCTC8325        SVCINGIITSILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIV
    Newman          SVCINGIITSILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIV
    USA300_FPR3757  SVCINGIITSILLNAKPHEVKLMLIDPKMVELNVYNGIPHLLIPVVTNPHKAAQALEKIV
                    ************************************************************

    COL             AEMERRYDLFQHSSTRNIKGYNELIRKQNQELDEKQPELPYIVVIVDELADLMMVAGKEV
    N315            AEMERRYDLFQHSSTRNIKGYNELIRKQNQELDEKQPELPYIVVIVDELADLMMVAGKEV
    NCTC8325        AEMERRYDLFQHSSTRNIKGYNELIRKQNQELDEKQPELPYIVVIVDELADLMMVAGKEV
    Newman          AEMERRYDLFQHSSTRNIKGYNELIRKQNQELDEKQPELPYIVVIVDELADLMMVAGKEV
    USA300_FPR3757  AEMERRYDLFQHSSTRNIKGYNELIRKQNQELDEKQPELPYIVVIVDELADLMMVAGKEV
                    ************************************************************

    COL             ENAIQRITQMARAAGIHLIVATQRPSVDVITGIIKNNIPSRIAFAVSSQTDSRTIIGTGG
    N315            ENAIQRITQMARAAGIHLIVATQRPSVDVITGIIKNNIPSRIAFAVSSQTDSRTIIGTGG
    NCTC8325        ENAIQRITQMARAAGIHLIVATQRPSVDVITGIIKNNIPSRIAFAVSSQTDSRTIIGTGG
    Newman          ENAIQRITQMARAAGIHLIVATQRPSVDVITGIIKNNIPSRIAFAVSSQTDSRTIIGTGG
    USA300_FPR3757  ENAIQRITQMARAAGIHLIVATQRPSVDVITGIIKNNIPSRIAFAVSSQTDSRTIIGTGG
                    ************************************************************

    COL             AEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVEQQQANYVKEMEPDAPVDK
    N315            AEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVEQQQANYVKEMEPDAPVDK
    NCTC8325        AEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVEQQQANYVKEMEPDAPVDK
    Newman          AEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVEQQQANYVKEMEPDAPVDK
    USA300_FPR3757  AEKLLGKGDMLYVGNGDSSQTRIQGAFLSDQEVQDVVNYVVEQQQANYVKEMEPDAPVDK
                    ************************************************************

    COL             SEMKSEDALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLERNQVIGPQKGSKP
    N315            SEMKSEDALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLERNQVIGPQKGSKP
    NCTC8325        SEMKSEDALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLERNQVIGPQKGSKP
    Newman          SEMKSEDALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLERNQVIGPQKGSKP
    USA300_FPR3757  SEMKSEDALYDEAYLFVVEQQKASTSLLQRQFRIGYNRASRLMDDLERNQVIGPQKGSKP
                    ************************************************************

    COL             RQVLIDLNNDEV
    N315            RQVLIDLNNDEV
    NCTC8325        RQVLIDLNNDEV
    Newman          RQVLIDLNNDEV
    USA300_FPR3757  RQVLIDLNNDEV
                    ************