From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003580000
  • symbol?:
  • description?: processing proteinase

      descriptions from strain specific annotations:

    • processing proteinase
    • peptidase M16 domain-containing protein
    • M16 family peptidase
    • peptidase, M16 family
    • insulinase (Peptidase family M16) family protein
    • peptidase M16 inactive domain protein
    • protease protein
    • zinc-dependent peptidase, M16 family
    • protease (zinc) protein
    • putative protease
    • peptidase M16 family protein
    • M16C subfamily peptidase
    • Zinc protease
  • strand?: +
  • coordinates?: 3921084..3922104
  • synteny block?: BlockID0026570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1237
    08BA02176:
    C248_1312
    11819-97:
    MS7_1237
    71193:
    ST398NM01_1281
    ECT-R 2:
    ECTR2_1135
    ED133:
    SAOV_1281
    ED98:
    SAAV_1254
    HO 5096 0412:
    SAEMRSA15_11120
    JH1:
    SaurJH1_1365
    JH9:
    SaurJH9_1339
    JKD6008:
    SAA6008_01234
    JKD6159:
    SAA6159_01134
    LGA251:
    SARLGA251_11900
    M013:
    M013TW_1220
    MRSA252:
    SAR1255
    MSHR1132:
    SAMSHR1132_11220
    MSSA476:
    SAS1213
    Mu3:
    SAHV_1269
    Mu50:
    SAV1279
    MW2:
    MW1162
    RF122:
    SAB1141
    ST398:
    SAPIG1281
    T0131:
    SAT0131_01335
    TCH60:
    HMPREF0772_11950
    TW20:
    SATW20_12730
    USA300_TCH1516:
    USA300HOU_1211
    VC40:
    SAVC_05560

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKERYYELIDERVFEQELENGLRLFIIPKPGFQKTFVTYTTQFGSLDNQFKPLGQDQFVT
    N315            MKERYYELIDERVFEQELENGLRLFIIPKPGFQKTFVTYTTQFGSLDNQFKPLGQDQFVT
    NCTC8325        MKERYYELIDERVFEQELENGLRLFIIPKPGFQKTFVTYTTQFGSLDNQFKPLGQDQFVT
    Newman          MKERYYELIDERVFEQELENGLRLFIIPKPGFQKTFVTYTTQFGSLDNQFKPLGQDQFVT
    USA300_FPR3757  MKERYYELIDERVFEQELENGLRLFIIPKPGFQKTFVTYTTQFGSLDNQFKPLGQDQFVT
                    ************************************************************

    COL             VPDGVAHFLEHKLFEKEEEDLFTAFAEDNAQANAFTSFDRTSYLFSATDNIENNIKRLLT
    N315            VPDGVAHFLEHKLFEKEEEDLFTAFAEDNAQANAFTSFDRTSYLFSATDNIENNIKRLLT
    NCTC8325        VPDGVAHFLEHKLFEKEEEDLFTAFAEDNAQANAFTSFDRTSYLFSATDNIENNIKRLLT
    Newman          VPDGVAHFLEHKLFEKEEEDLFTAFAEDNAQANAFTSFDRTSYLFSATDNIENNIKRLLT
    USA300_FPR3757  VPDGVAHFLEHKLFEKEEEDLFTAFAEDNAQANAFTSFDRTSYLFSATDNIENNIKRLLT
                    ************************************************************

    COL             MVETPYFTKETVDKEKGIIAEEIKMYQEQPGYKLMFDTLRAMYQQHPIRVDIAGSVESIY
    N315            MVETPYFTKETVDKEKGIIAEEIKMYQEQPGYKLMFNTLRAMYQRHPIRVDIAGSVESIY
    NCTC8325        MVETPYFTKETVDKEKGIIAEEIKMYQEQPGYKLMFNTLRAMYQQHPIRVDIAGSVESIY
    Newman          MVETPYFTKETVDKEKGIIAEEIKMYQEQPGYKLMFDTLRAMYQQHPIRVDIAGSVESIY
    USA300_FPR3757  MVETPYFTKETVDKEKGIIAEEIKMYQEQPGYKLMFDTLRAMYQQHPIRVDIAGSVESIY
                    ************************************:*******:***************

    COL             DITKDDLYLCYETFYHPSNMVLFVVGDVDPEAICRIVKQHEDARNKVNQPKIERGLVDEP
    N315            DITKDDLYLCYETFYHPSNMVLFVVGDVNPEEICRIVKQHEDARNKVNQPKIERGLVDEP
    NCTC8325        DITKDDLYLCYETFYHPSNMVLFVVGDVDPEAICRIVKQHEDARNKVNQPKIERGLVDEP
    Newman          DITKDDLYLCYETFYHPSNMVLFVVGDVDPEAICRIVKQHEDARNKVNQPKIERGLVDEP
    USA300_FPR3757  DITKDDLYLCYETFYHPSNMVLFVVGDVDPEAICRIVKQHEDARNKVNQPKIERGLVDEP
                    ****************************:** ****************************

    COL             EDVKEAFVTESMKIQSPRLMLGFKNKPLQEAPQKYVQRDLEMSLFFELIFGEETDFYQNL
    N315            EDVKEAFVTESMKIQSPRLMLGFKNKPLQEAPQKYVQRDLEMSLFFELIFGEETDFYQNL
    NCTC8325        EDVKEAFVTESMKIQSPRLMLGFKNKPLQEAPQKYVQRDLEMSLFFELIFGEETDFYQNL
    Newman          EDVKEAFVTESMKIQSPRLMLGFKNKPLQEAPQKYVQRDLEMSLFFELIFGEETDFYQNL
    USA300_FPR3757  EDVKEAFVTESMKIQSPRLMLGFKNKPLQEAPQKYVQRDLEMSLFFELIFGEETDFYQNL
                    ************************************************************

    COL             LNEGLIDDTFGYQFVLEPTYSFSIVTSATEEPDKLKKLLLDELRDKKGNFQDAEAFELLK
    N315            LNEGLIDDTFGYQFVLEPTYSFSIVTSATEEPDKLKKLLLDELRDKKGNFQDAEAFELLK
    NCTC8325        LNEGLIDDTFGYQFVLEPTYSFSIVTSATEEPDKLKKLLLDELRDKKGNFQDAEAFELLK
    Newman          LNEGLIDDTFGYQFVLEPTYSFSIVTSATEEPDKLKKLLLDELRDKKGNFQDAEAFELLK
    USA300_FPR3757  LNEGLIDDTFGYQFVLEPTYSFSIVTSATEEPDKLKKLLLDELRDKKGNFQDAEAFELLK
                    ************************************************************

    COL             KQFIGEFISSLNSPEYIANQYTKLYFEGVSVFDMLDIVENITLDSINETSSLYLNLDQQV
    N315            KQFIGEFISSLNSPEYIANQYTKLYFEGVSVFDMLDIVENITLDSINETSSLYLNLDQQV
    NCTC8325        KQFIGEFISSLNSPEYIANQYTKLYFEGVSVFDMLDIVENITLDSINETSSLYLNLDQQV
    Newman          KQFIGEFISSLNSPEYIANQYTKLYFEGVSVFDMLDIVENITLDSINETSSLYLNLDQQV
    USA300_FPR3757  KQFIGEFISSLNSPEYIANQYTKLYFEGVSVFDMLDIVENITLDSINETSSLYLNLDQQV
                    ************************************************************

    COL             DSRLEIKK
    N315            DSRLEIKK
    NCTC8325        DSRLEIKK
    Newman          DSRLEIKK
    USA300_FPR3757  DSRLEIKK
                    ********