From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003583000
  • symbol?:
  • description?: ACT domain-containing protein

      descriptions from strain specific annotations:

    • ACT domain-containing protein
    • ACT domain protein
    • amino acid-binding ACT domain-containing protein
    • amino acid-binding ACT protein
    • membrane protein
    • protein with ACT domain
  • strand?: +
  • coordinates?: 3923126..3924011
  • synteny block?: BlockID0026600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1239
    08BA02176:
    C248_1314
    11819-97:
    MS7_1239
    71193:
    ST398NM01_1283
    ECT-R 2:
    ECTR2_1137
    ED133:
    SAOV_1283
    ED98:
    SAAV_1256
    HO 5096 0412:
    SAEMRSA15_11140
    JH1:
    SaurJH1_1367
    JH9:
    SaurJH9_1341
    JKD6008:
    SAA6008_01236
    JKD6159:
    SAA6159_01136
    LGA251:
    SARLGA251_11920
    M013:
    M013TW_1223
    MRSA252:
    SAR1257
    MSHR1132:
    SAMSHR1132_11240
    MSSA476:
    SAS1215
    Mu3:
    SAHV_1271
    Mu50:
    SAV1281
    MW2:
    MW1164
    RF122:
    SAB1143
    ST398:
    SAPIG1283
    T0131:
    SAT0131_01337
    TCH60:
    HMPREF0772_11947
    TW20:
    SATW20_12750
    USA300_TCH1516:
    USA300HOU_1213
    VC40:
    SAVC_05570

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVAEKKEWYLEYEIEINRPGLLGDVSSLLGMLGISIVTINGVDQGKRGLLIKTDNLEKV
    N315            MTVAEKKEWYLEYEIEINRPGLLGDVSSLLGMLGISIVTINGVDQGKRGLLIKTDNLEKV
    NCTC8325        MTVAEKKEWYLEYEIEINRPGLLGDVSSLLGMLGISIVTINGVDQGKRGLLIKTDNLEKV
    Newman          MTVAEKKEWYLEYEIEINRPGLLGDVSSLLGMLGISIVTINGVDQGKRGLLIKTDNLEKV
    USA300_FPR3757  MTVAEKKEWYLEYEIEINRPGLLGDVSSLLGMLGISIVTINGVDQGKRGLLIKTDNLEKV
                    ************************************************************

    COL             ERFEQIARGINEIEITKLKKPELRDRLAVRHGRYIEQDAKDKKTFRFEREDLGLLVDFLA
    N315            ERFEQIARGINEIEITKLKKPELRDRLAVRHGRYIEQDAKDKKTFRFEREDLGLLVDFLA
    NCTC8325        ERFEQIARGINEIEITKLKKPELRDRLAVRHGRYIEQDAKDKKTFRFEREDLGLLVDFLA
    Newman          ERFEQIARGINEIEITKLKKPELRDRLAVRHGRYIEQDAKDKKTFRFEREDLGLLVDFLA
    USA300_FPR3757  ERFEQIARGINEIEITKLKKPELRDRLAVRHGRYIEQDAKDKKTFRFEREDLGLLVDFLA
                    ************************************************************

    COL             ELFKEEGHKLIGIRGMPRVGKTESIVAGSVCAHKRWLFISSTLIKQTVRSSLIKGEYDAN
    N315            ELFKEEGHKLIGIRGMPRVGKTESIVAGSVCAHKRWLFISSTLIKQTVRSSLIKGEYDAN
    NCTC8325        ELFKEEGHKLIGIRGMPRVGKTESIVAGSVCAHKRWLFISSTLIKQTVRSSLIKGEYDAN
    Newman          ELFKEEGHKLIGIRGMPRVGKTESIVAGSVCAHKRWLFISSTLIKQTVRSSLIKGEYDAN
    USA300_FPR3757  ELFKEEGHKLIGIRGMPRVGKTESIVAGSVCAHKRWLFISSTLIKQTVRSSLIKGEYDAN
                    ************************************************************

    COL             HVYIIDGAVTARESNPKHQELVNEVMTLPSIKVVEHPDLFVETSTCTMEDFDYIIELREN
    N315            HVYIIDGAVTARESNPKHQELVNEVMTLPSIKVVEHPDLFVETSTCTMEDFDYIIELREN
    NCTC8325        HVYIIDGAVTARESNPKHQELVNEVMTLPSIKVVEHPDLFVETSTCTMEDFDYIIELREN
    Newman          HVYIIDGAVTARESNPKHQELVNEVMTLPSIKVVEHPDLFVETSTCTMEDFDYIIELREN
    USA300_FPR3757  HVYIIDGAVTARESNPKHQELVNEVMTLPSIKVVEHPDLFVETSTCTMEDFDYIIELREN
                    ************************************************************

    COL             ENQEIHYEEMKKQTVQSKNNLDFGDPFGGGFGFFE
    N315            ENQEIHYEEMKKQTVQSKNNLDFGDPFGGGFGFFE
    NCTC8325        ENQEIHYEEMKKQTVQSKNNLDFGDPFGGGFGFFE
    Newman          ENQEIHYEEMKKQTVQSKNNLDFGDPFGGGFGFFE
    USA300_FPR3757  ENQEIHYEEMKKQTVQSKNNLDFGDPFGGGFGFFE
                    ***********************************