From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003593000
  • symbol?:
  • description?: 2-oxoglutarate ferredoxin oxidoreductase subunit beta

      descriptions from strain specific annotations:

    • 2-oxoglutarate ferredoxin oxidoreductase subunit beta
    • 2-oxoacid ferredoxin oxidoreductase subunit beta
    • 2-oxoacid:ferredoxin oxidoreductase subunit beta
    • 2-oxoglutarate oxidoreductase, beta subunit
    • 2-oxoglutarate oxidoreductase subunit beta
    • acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family protein
    • ferrodoxin oxidoreductase beta subunit
    • Pyruvate ferredoxin/flavodoxin oxidoreductase, beta subunit
    • pyruvate ferredoxin oxidoreductase beta chain
    • pyruvate ferredoxin oxidoreductase subunit beta
  • strand?: +
  • coordinates?: 3935677..3936543
  • synteny block?: BlockID0026700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1199 (porB)
    USA300_FPR3757:
    04-02981:
    SA2981_1248
    08BA02176:
    C248_1323
    11819-97:
    MS7_1248
    71193:
    ST398NM01_1292
    ECT-R 2:
    ECTR2_1146
    ED133:
    SAOV_1292
    ED98:
    SAAV_1265
    HO 5096 0412:
    SAEMRSA15_11250
    JH1:
    SaurJH1_1376
    JH9:
    SaurJH9_1350
    JKD6008:
    SAA6008_01245 (porB)
    JKD6159:
    SAA6159_01145 (porB)
    LGA251:
    SARLGA251_12010
    M013:
    M013TW_1232
    MRSA252:
    SAR1266
    MSHR1132:
    SAMSHR1132_11330
    MSSA476:
    SAS1224
    Mu3:
    SAHV_1280
    Mu50:
    SAV1290
    MW2:
    MW1173
    RF122:
    SAB1152
    ST398:
    SAPIG1292
    T0131:
    SAT0131_01346 (idi)
    TCH60:
    HMPREF0772_11938 (porB)
    TW20:
    SATW20_12840
    USA300_TCH1516:
    USA300HOU_1222 (porB)
    VC40:
    SAVC_05615

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MATFKDFRNNVKPNWCPGCGDFSVQAAIQKAAANIGLEPEEVAIITGIGCSGRLSGYINS
    N315            MATFKDFRNNVKPNWCPGCGDFSVQAAIQKAAANIGLEPEEVAIITGIGCSGRLSGYINS
    NCTC8325        MATFKDFRNNVKPNWCPGCGDFSVQAAIQKAAANIGLEPEEVAIITGIGCSGRLSGYINS
    Newman          MATFKDFRNNVKPNWCPGCGDFSVQAAIQKAAANIGLEPEEVAIITGIGCSGRLSGYINS
    USA300_FPR3757  MATFKDFRNNVKPNWCPGCGDFSVQAAIQKAAANIGLEPEEVAIITGIGCSGRLSGYINS
                    ************************************************************

    COL             YGVHSIHGRALPLAQGVKMANKDLTVIASGGDGDGYAIGMGHTIHALRRNMNMTYIVMDN
    N315            YGVHSIHGRALPLAQGVKMANKDLTVIASGGDGDGYAIGMGHTIHALRRNMNMTYIVMDN
    NCTC8325        YGVHSIHGRALPLAQGVKMANKDLTVIASGGDGDGYAIGMGHTIHALRRNMNMTYIVMDN
    Newman          YGVHSIHGRALPLAQGVKMANKDLTVIASGGDGDGYAIGMGHTIHALRRNMNMTYIVMDN
    USA300_FPR3757  YGVHSIHGRALPLAQGVKMANKDLTVIASGGDGDGYAIGMGHTIHALRRNMNMTYIVMDN
                    ************************************************************

    COL             QIYGLTKGQTSPSSAVGFVTKTTPKGNIEKNVAPLELALSSGATFVAQGFSSDIKGLTKL
    N315            QIYGLTKGQTSPSSAVGFVTKTTPKGNIEKNVAPLELALSSGATFVAQGFSSDIKGLTKL
    NCTC8325        QIYGLTKGQTSPSSAVGFVTKTTPKGNIEKNVAPLELVLSSGATFVAQGFSSDIKGLTKL
    Newman          QIYGLTKGQTSPSSAVGFVTKTTPKGNIEKNVAPLELALSSGATFVAQGFSSDIKGLTKL
    USA300_FPR3757  QIYGLTKGQTSPSSAVGFVTKTTPKGNIEKNVAPLELALSSGATFVAQGFSSDIKGLTKL
                    *************************************.**********************

    COL             IEDAINHDGFSFVNVFSPCVTYNKINTYDWFKEHLTSVDDIENYDSTDKQLATKTVIEHE
    N315            IEDAINHDGFSFVNVFSPCVTYNKINTYDWFKEHLTSVDDIENYDSTDKQLATKTVIEHE
    NCTC8325        IEDAINHDGFSFVNVFSPCVTYNKINTYDWFKEHLTSVDDIENYDSTDKQLATKTVIEHE
    Newman          IEDAINHDGFSFVNVFSPCVTYNKINTYDWFKEHLTSVDDIENYDSTDKQLATKTVIEHE
    USA300_FPR3757  IEDAINHDGFSFVNVFSPCVTYNKINTYDWFKEHLTSVDDIENYDSTDKQLATKTVIEHE
                    ************************************************************

    COL             SLVTGIVYQDKETPSYESQIKELDDTPLAKRDIKITEDTFNALTEQFI
    N315            SLVTGIVYQDKETPSYESQIKELDDTPLAKRDIKITEDTFNALTEQFI
    NCTC8325        SLVTGIVYQDKETPSYESQIKELDDTPLAKRDIKITEDTFNALTEQFI
    Newman          SLVTGIVYQDKETPSYESQIKELDDTPLAKRDIKITEDTFNALTEQFI
    USA300_FPR3757  SLVTGIVYQDKETPSYESQIKELDDTPLAKRDIKITEDTFNALTEQFI
                    ************************************************