From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003598000
  • symbol?:
  • description?: energy coupling factor transporter S component ThiW

      descriptions from strain specific annotations:

    • energy coupling factor transporter S component ThiW
    • hydroxyethylthiazole permease
    • membrane protein
    • putative thiamine-precursor transporter protein (ThiW)
    • Substrate-specific component ThiWthiazole ECF transporter
    • Thiamine-precursor transporter protein
    • thiamine- transporter family protein
    • thiamine-transporter protein (ThiW) family protein
    • thiazole ECF transporter substrate-specific proteinThiW
    • ThiW protein
  • strand?: +
  • coordinates?: 3940079..3940570
  • synteny block?: BlockID0026750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1252 (thiW)
    08BA02176:
    C248_1328
    11819-97:
    MS7_1252
    71193:
    ST398NM01_1297
    ECT-R 2:
    ECTR2_1150
    ED133:
    SAOV_1296
    ED98:
    SAAV_1269
    HO 5096 0412:
    SAEMRSA15_11290
    JH1:
    SaurJH1_1380
    JH9:
    SaurJH9_1354
    JKD6008:
    SAA6008_01249
    JKD6159:
    SAA6159_01149
    LGA251:
    SARLGA251_12050
    M013:
    M013TW_1236
    MRSA252:
    SAR1270
    MSHR1132:
    SAMSHR1132_11370
    MSSA476:
    SAS1228
    Mu3:
    SAHV_1284
    Mu50:
    SAV1294
    MW2:
    MW1177
    RF122:
    SAB1156
    ST398:
    SAPIG1297 (thiW)
    T0131:
    SAT0131_01350
    TCH60:
    HMPREF0772_11934 (thiW)
    TW20:
    SATW20_12880
    USA300_TCH1516:
    USA300HOU_1226
    VC40:
    SAVC_05635

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSRKLAITALLIAINVVLSSIIIIPLGPVKAAPVQHFVNVLSAVIVGPWYGLAQALISS
    N315            MKSRKLAITALLIAINVVLSSIIIIPLGPVKAAPVQHFVNVLSAVIVGPWYGLAQALISS
    NCTC8325        MKSRKLAITALLIAINVVLSSIIIIPLGPVKAAPVQHFVNVLSAVIVGPWYGLAQALISS
    Newman          MKSRKLAITALLIAINVVLSSIIIIPLGPVKAAPVQHFVNVLSAVIVGPWYGLAQALISS
    USA300_FPR3757  MKSRKLAITALLIAINVVLSSIIIIPLGPVKAAPVQHFVNVLSAVIVGPWYGLAQALISS
                    ************************************************************

    COL             ILRVLFGTGTAFAFPGSMIGVLLASMFYIYRKHIFMAAVGEVLGTGVIGSLICIPLAYFL
    N315            ILRVLFGTGTAFAFPGSMIGVLLASMFYIYRKHIFMAAVGEVLGTGVIGSLICIPLAYFL
    NCTC8325        ILRVLFGTGTAFAFPGSMIGVLLASMFYIYRKHIFMAAVGEVLGTGVIGSLICIPLAYFL
    Newman          ILRVLFGTGTAFAFPGSMIGVLLASMFYIYRKHIFMAAVGEVLGTGVIGSLICIPLAYFL
    USA300_FPR3757  ILRVLFGTGTAFAFPGSMIGVLLASMFYIYRKHIFMAAVGEVLGTGVIGSLICIPLAYFL
                    ************************************************************

    COL             GLQDFFIKPLMITFIVSSAIGSIISYFLLITLKKRGILQRFIK
    N315            GLQDFFIKPLMITFIVSSAIGSIISYFLLITLKKRGILQRFIK
    NCTC8325        GLQDFFIKPLMITFIVSSAIGSIISYFLLITLKKRGILQRFIK
    Newman          GLQDFFIKPLMITFIVSSAIGSIISYFLLITLKKRGILQRFIK
    USA300_FPR3757  GLQDFFIKPLMITFIVSSAIGSIISYFLLITLKKRGILQRFIK
                    *******************************************