From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003600000
  • symbol?: mutS
  • description?: DNA mismatch repair protein MutS
  • strand?: +
  • coordinates?: 3940916..3948400
  • synteny block?: BlockID0026770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1315 (hexA)
    N315:
    SA1137 (mutS)
    NCTC8325:
    Newman:
    NWMN_1204 (mutS)
    USA300_FPR3757:
    04-02981:
    SA2981_1253 (mutS)
    08BA02176:
    C248_1329 (mutS)
    11819-97:
    MS7_1253 (mutS)
    71193:
    ST398NM01_1298
    ECT-R 2:
    ECTR2_1151 (mutS)
    ED133:
    SAOV_1297 (mutS)
    ED98:
    SAAV_1270 (hexA)
    HO 5096 0412:
    SAEMRSA15_11300 (mutS)
    JH1:
    SaurJH1_1381
    JH9:
    SaurJH9_1355
    JKD6008:
    SAA6008_01250 (mutS)
    JKD6159:
    SAA6159_01150 (mutS)
    LGA251:
    SARLGA251_12060 (mutS)
    M013:
    M013TW_1237
    MRSA252:
    SAR1271 (mutS)
    MSHR1132:
    SAMSHR1132_11380
    MSSA476:
    SAS1229
    Mu3:
    SAHV_1285 (mutS)
    Mu50:
    SAV1295 (mutS)
    MW2:
    MW1178 (mutS)
    RF122:
    SAB1157 (mutS)
    ST398:
    SAPIG1298 (mutS)
    T0131:
    SAT0131_01351
    TCH60:
    HMPREF0772_11933 (mutS2)
    TW20:
    SATW20_12890 (mutS)
    USA300_TCH1516:
    USA300HOU_1227 (mutS1)
    VC40:
    SAVC_05675

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNVTPMMQQYLKIKSEYQDCLLFFRLGDFYEMFYEDAKEASRVLEITLTKRDAKKENPI
    N315            MSNVTPMMQQYLKIKSEYQDCLLFFRLGDFYEMFYEDAKEASRVLEITLTKRDAKKENPI
    NCTC8325        --------------------------------MFYEDAKEASRVLEITLTKRDAKKENPI
    Newman          MSNVTPMMQQYLKIKSEYQDCLLFFRLGDFYEMFYEDAKEASRVLEITLTKRDAKKENPI
    USA300_FPR3757  --------------------------------MFYEDAKEASRVLEITLTKRDAKKENPI
                                                    ****************************

    COL             PMCGVPYHSADSYIDTLVNNGYKVAICEQMEDPKQTKGMVRREVVRIVTPGTVMEQGGVD
    N315            PMCGVPYHSADSYIDTLVNNGYKVAICEQMEDPKQTKGMVRREVVRIVTPGTVMEQGGVD
    NCTC8325        PMCGVPYHSADSYIDTLVNNGYKVAICEQMEDPKQTKGMVRREVVRIVTPGTVMEQGGVD
    Newman          PMCGVPYHSADSYIDTLVNNGYKVAICEQMEDPKQTKGMVRREVVRIVTPGTVMEQGGVD
    USA300_FPR3757  PMCGVPYHSADSYIDTLVNNGYKVAICEQMEDPKQTKGMVRREVVRIVTPGTVMEQGGVD
                    ************************************************************

    COL             DKQNNYILSFVMNQPEIALSYCDVSTGELKVTHFNDEATLLNEITTINPNEVVINDNISD
    N315            DKQNNYILSFVMNQPEIALSYCDVSTGELKVTHFNDEATLLNEITTINPNEVVINDNISD
    NCTC8325        DKQNNYILSFVMNQPEIALSYCDVSTGELKVTHFNDEATLLNEITTINPNEVVINDNISD
    Newman          DKQNNYILSFVMNQPEIALSYCDVSTGELKVTHFNDEATLLNEITTINPNEVVINDNISD
    USA300_FPR3757  DKQNNYILSFVMNQPEIALSYCDVSTGELKVTHFNDEATLLNEITTINPNEVVINDNISD
                    ************************************************************

    COL             NLKRQINMVTETITVRETLSSEIYSVNQTEHKLMYQATQLLLDYIHHTQKRDLSHIEDVV
    N315            NLKRQINMVTETITVRETLSSEIYSVNQTEHKLMYQATQLLLDYIHHTQKRDLSHIEDVV
    NCTC8325        NLKRQINMVTETITVRETLSSEIYSVNQTEHKLMYQATQLLLDYIHHTQKRDLSHIEDVV
    Newman          NLKRQINMVTETITVRETLSSEIYSVNQTEHKLMYQATQLLLDYIHHTQKRDLSHIEDVV
    USA300_FPR3757  NLKRQINMVTETITVRETLSSEIYSVNQTEHKLMYQATQLLLDYIHHTQKRDLSHIEDVV
                    ************************************************************

    COL             QYAAIDYMKMDFYAKRNLELTESIRLKSKKGTLLWLMDETKTPMGARRLKQWIDRPLISK
    N315            QYAAIDYMKMDFYAKRNLELTESIRLKSKKGTLLWLMDETKTPMGARRLKQWIDRPLISK
    NCTC8325        QYAAIDYMKMDFYAKRNLELTESIRLKSKKGTLLWLMDETKTPMGARRLKQWIDRPLISK
    Newman          QYAAIDYMKMDFYAKRNLELTESIRLKSKKGTLLWLMDETKTPMGARRLKQWIDRPLISK
    USA300_FPR3757  QYAAIDYMKMDFYAKRNLELTESIRLKSKKGTLLWLMDETKTPMGARRLKQWIDRPLISK
                    ************************************************************

    COL             EQIEARLDIVDEFSAHFIERDTLRTYLNQVYDIERLVGRVSYGNVNARDLIQLKHSISEI
    N315            EQIEARLDIVDEFSAHFIERDTLRTYLNQVYDIERLVGRVSYGNVNARDLIQLKHSISEI
    NCTC8325        EQIEARLDIVDEFSAHFIERDTLRTYLNQVYDIERLVGRVSYGNVNARDLIQLKHSISEI
    Newman          EQIEARLDIVDEFSAHFIERDTLRTYLNQVYDIERLVGRVSYGNVNARDLIQLKHSISEI
    USA300_FPR3757  EQIEARLDIVDEFSAHFIERDTLRTYLNQVYDIERLVGRVSYGNVNARDLIQLKHSISEI
                    ************************************************************

    COL             PNIKALLNSMNQNTLVQVNQLEPLDDLLDILEQSLVEEPPISVKDGGLFKVGFNTQLDEY
    N315            PNIKALLNSMNQNTLVQVNQLEPLDDLLDILEQSLVEEPPISVKDGGLFKVGFNTQLDEY
    NCTC8325        PNIKALLNSMNQNTLVQVNQLEPLDDLLDILEQSLVEEPPISVKDGGLFKVGFNTQLDEY
    Newman          PNIKALLNSMNQNTLVQVNQLEPLDDLLDILEQSLVEEPPISVKDGGLFKVGFNTQLDEY
    USA300_FPR3757  PNIKALLNSMNQNTLVQVNQLEPLDDLLDILEQSLVEEPPISVKDGGLFKVGFNTQLDEY
                    ************************************************************

    COL             LEASKNGKTWLAELQAKERQRTGIKSLKISFNKVFGYFIEITRANLQNFEPSEFGYMRKQ
    N315            LEASKNGKTWLAELQAKERQRTGIKSLKISFNKVFGYFIEITRANLQNFEPSEFGYMRKQ
    NCTC8325        LEASKNGKTWLAELQAKERQRTGIKSLKISFNKVFGYFIEITRANLQNFEPSEFGYMRKQ
    Newman          LEASKNGKTWLAELQAKERQRTGIKSLKISFNKVFGYFIEITRANLQNFEPSEFGYMRKQ
    USA300_FPR3757  LEASKNGKTWLAELQAKERQRTGIKSLKISFNKVFGYFIEITRANLQNFEPSEFGYMRKQ
                    ************************************************************

    COL             TLSNAERFITDELKEKEDIILGAEDKAIELEYQLFVQLREEVKKYTERLQQQAKIISELD
    N315            TLSNAERFITDELKEKEDIILGAEDKAIELEYQLFVQLREEVKKYTERLQQQAKIISELD
    NCTC8325        TLSNAERFITDELKEKEDIILGAEDKAIELEYQLFVQLREEVKKYTERLQQQAKIISELD
    Newman          TLSNAERFITDELKEKEDIILGAEDKAIELEYQLFVQLREEVKKYTERLQQQAKIISELD
    USA300_FPR3757  TLSNAERFITDELKEKEDIILGAEDKAIELEYQLFVQLREEVKKYTERLQQQAKIISELD
                    ************************************************************

    COL             CLQSFAEIAQKYNYTRPSFSENKTLELVESRHPVVERVMDYNDYVPNNCRLDNETFIYLI
    N315            CLQSFAEIAQKYNYTRPSFSENKTLELVESRHPVVERVMDYNDYVPNNCRLDNETFIYLI
    NCTC8325        CLQSFAEIAQKYNYTRPSFSENKTLELVESRHPVVERVMDYNDYVPNNCRLDNETFIYLI
    Newman          CLQSFAEIAQKYNYTRPSFSENKTLELVESRHPVVERVMDYNDYVPNNCRLDNETFIYLI
    USA300_FPR3757  CLQSFAEIAQKYNYTRPSFSENKTLELVESRHPVVERVMDYNDYVPNNCRLDNETFIYLI
                    ************************************************************

    COL             TGPNMSGKSTYMRQVAIISIMAQMGAYVPCKEAVLPIFDQIFTRIGAADDLVSGKSTFMV
    N315            TGPNMSGKSTYMRQVAIISIMAQMGAYVPCKEAVLPIFDQIFTRIGAADDLVSGKSTFMV
    NCTC8325        TGPNMSGKSTYMRQVAIISIMAQMGAYVPCKEAVLPIFDQIFTRIGAADDLVSGKSTFMV
    Newman          TGPNMSGKSTYMRQVAIISIMAQMGAYVPCKEAVLPIFDQIFTRIGAADDLVSGKSTFMV
    USA300_FPR3757  TGPNMSGKSTYMRQVAIISIMAQMGAYVPCKEAVLPIFDQIFTRIGAADDLVSGKSTFMV
                    ************************************************************

    COL             EMLEAQKALTYATEDSLIIFDEIGRGTSTYDGLALAQAMIEYVAETSHAKTLFSTHYHEL
    N315            EMLEAQKALTYATEDSLIIFDEIGRGTSTYDGLALAQAMIEYVAETSHAKTLFSTHYHEL
    NCTC8325        EMLEAQKALTYATEDSLIIFDEIGRGTSTYDGLALAQAMIEYVAETSHAKTLFSTHYHEL
    Newman          EMLEAQKALTYATEDSLIIFDEIGRGTSTYDGLALAQAMIEYVAETSHAKTLFSTHYHEL
    USA300_FPR3757  EMLEAQKALTYATEDSLIIFDEIGRGTSTYDGLALAQAMIEYVAETSHAKTLFSTHYHEL
                    ************************************************************

    COL             TTLDQALPSLKNVHVAANEYKGELIFLHKVKDGAVDDSYGIQVAKLADLPEKVISRAQVI
    N315            TTLDQALPSLKNVHVAANEYKGELIFLHKVKDGAVDDSYGIQVAKLADLPEKVISRAQVI
    NCTC8325        TTLDQALPSLKNVHVAANEYKGELIFLHKVKDGAVDDSYGIQVAKLADLPEKVISRAQVI
    Newman          TTLDQALPSLKNVHVAANEYKGELIFLHKVKDGAVDDSYGIQVAKLADLPEKVISRAQVI
    USA300_FPR3757  TTLDQALPSLKNVHVAANEYKGELIFLHKVKDGAVDDSYGIQVAKLADLPEKVISRAQVI
                    ************************************************************

    COL             LSEFEASAGKKSSISNLKMVENEPEINQENLNLSVEETTDTLSQKDFEQASFDLFENDQE
    N315            LSEFEASAGKKSSISNLKMVENEPEINQENLNLSVEETTDTLSQKDFEQASFDLFENDQE
    NCTC8325        LSEFEASAGKKSSISNLKMVENEPEINQENLNLSVEETTDTLSQKDFEQASFDLFENDQK
    Newman          LSEFEASAGKKSSISNLKMVENEPEINQENLNLSVEETTDTLSQKDFEQASFDLFENDQE
    USA300_FPR3757  LSEFEASAGKKSSISNLKMVENEPEINQENLNLSVEETTDTLSQKDFEQASFDLFENDQE
                    ***********************************************************:

    COL             SEIELQIKNLNLSNMTPIEALVKLSELQNQLK
    N315            SEIELQIKNLNLSNMTPIEALVKLSELQNQLK
    NCTC8325        SEIELQIKNLNLSNMTPIEALVKLSELQNQLK
    Newman          SEIELQIKNLNLSNMTPIEALVKLSELQNQLK
    USA300_FPR3757  SEIELQIKNLNLSNMTPIEALVKLSELQNQLK
                    ********************************