From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003612000
  • symbol?: glpK
  • description?: glycerol kinase
  • strand?: +
  • coordinates?: 3952377..3953972
  • synteny block?: BlockID0026830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1320 (glpK)
    N315:
    SA1141 (glpK)
    NCTC8325:
    Newman:
    NWMN_1208 (glpK)
    USA300_FPR3757:
    04-02981:
    SA2981_1257 (glpK)
    08BA02176:
    C248_1334 (glpK)
    11819-97:
    MS7_1257 (glpK)
    71193:
    ST398NM01_1302
    ECT-R 2:
    ECTR2_1157 (glpK)
    ED133:
    SAOV_1301 (glpK)
    ED98:
    SAAV_1274 (glpK)
    HO 5096 0412:
    SAEMRSA15_11340 (glpK)
    JH1:
    SaurJH1_1385 (glpK)
    JH9:
    SaurJH9_1359 (glpK)
    JKD6008:
    SAA6008_01254 (glpK)
    JKD6159:
    SAA6159_01154 (glpK)
    LGA251:
    SARLGA251_12100 (glpK)
    M013:
    M013TW_1241
    MRSA252:
    SAR1275 (glpK)
    MSHR1132:
    SAMSHR1132_11420
    MSSA476:
    SAS1233 (glpK)
    Mu3:
    SAHV_1290 (glpK)
    Mu50:
    SAV1301 (glpK)
    MW2:
    MW1183 (glpK)
    RF122:
    SAB1161 (glpK)
    ST398:
    SAPIG1302 (glpK)
    T0131:
    SAT0131_01355 (tcaB)
    TCH60:
    HMPREF0772_11927 (glpK)
    TW20:
    SATW20_12930 (glpK)
    USA300_TCH1516:
    USA300HOU_1231 (glpK)
    VC40:
    SAVC_05695 (glpK)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
    N315            MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
    NCTC8325        MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
    Newman          MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
    USA300_FPR3757  MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
                    ************************************************************

    COL             EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
    N315            EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
    NCTC8325        EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
    Newman          EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
    USA300_FPR3757  EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
                    ************************************************************

    COL             QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
    N315            QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
    NCTC8325        QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
    Newman          QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
    USA300_FPR3757  QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
                    ************************************************************

    COL             DYSNASRTLMFNIHDLEWDDELLELLTVPKNMLPEVKASSEVYGKTIDYHFYGQEVPIAG
    N315            DYSNASRTLMFNIHDLEWDDELLELLTVPKNMLPEVKPSSEIYGKTIDYHFYGQEVPIAG
    NCTC8325        DYSNASRTLMFNIHDLEWDDELLELLTVPKNMLPEVKASSEVYGKTIDYHFYGQEVPIAG
    Newman          DYSNASRTLMFNIHDLEWDDELLELLTVPKNMLPEVKASSEVYGKTIDYHFYGQEVPIAG
    USA300_FPR3757  DYSNASRTLMFNIHDLEWDDELLELLTVPKNMLPEVKASSEVYGKTIDYHFYGQEVPIAG
                    *************************************.***:******************

    COL             VAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGKVNYA
    N315            VAGDQQAALFGQACFECGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGKVNYA
    NCTC8325        VAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGKVNYA
    Newman          VAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGKVNYA
    USA300_FPR3757  VAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGKVNYA
                    **************** *******************************************

    COL             LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
    N315            LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
    NCTC8325        LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
    Newman          LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
    USA300_FPR3757  LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
                    ************************************************************

    COL             GAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
    N315            GAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
    NCTC8325        GAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
    Newman          GAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
    USA300_FPR3757  GAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
                    ************************************************************

    COL             QADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREK
    N315            QADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREK
    NCTC8325        QADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREK
    Newman          QADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREK
    USA300_FPR3757  QADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREK
                    ************************************************************

    COL             LYRGWKKAVEATQVFKTE
    N315            LYRGWKKAVEATQVFKTE
    NCTC8325        LYRGWKKAVEATQVFKTE
    Newman          LYRGWKKAVEATQVFKTE
    USA300_FPR3757  LYRGWKKAVEATQVFKTE
                    ******************