From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN003627000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3965406..3965603
  • synteny block?: BlockID0026970
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_1344
    11819-97:
    MS7_1267
    71193:
    ST398NM01_1312
    ECT-R 2:
    ED133:
    SAOV_1311
    ED98:
    SAAV_1284
    HO 5096 0412:
    SAEMRSA15_11440
    JH1:
    SaurJH1_1395
    JH9:
    JKD6008:
    SAA6008_01264
    JKD6159:
    LGA251:
    SARLGA251_12200
    M013:
    M013TW_1251
    MRSA252:
    SAR1285
    MSHR1132:
    MSSA476:
    SAS1243
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    SAPIG1312
    T0131:
    SAT0131_01367
    TCH60:
    HMPREF0772_11916
    TW20:
    SATW20_13030
    USA300_TCH1516:
    USA300HOU_1241
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNCYDEIFNTIKELIENKEISSYQINKDTGISYGNINAMRRRERRIENLSLKNAKILYEY
    NCTC8325        MNCYDEIFNTIKELIENKEISSYQINKDTGISYGNINAMRRRERRIENLSLKNAKILYEY
                    ************************************************************

    COL             AKKVL
    NCTC8325        AKKVL
                    *****