From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003629000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3966298..3966516
  • synteny block?: BlockID0026990
  • occurrence?: in 69% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    MS7_1268
    71193:
    ECT-R 2:
    ECTR2_1167
    ED133:
    SAOV_1312
    ED98:
    SAAV_1285
    HO 5096 0412:
    SAEMRSA15_11450
    JH1:
    SaurJH1_1396
    JH9:
    SaurJH9_1369
    JKD6008:
    SAA6008_01265
    JKD6159:
    SAA6159_01164
    LGA251:
    SARLGA251_12220
    M013:
    M013TW_1252
    MRSA252:
    SAR1302
    MSHR1132:
    SAMSHR1132_11520
    MSSA476:
    SAS1244
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_01368 (mqo)
    TCH60:
    HMPREF0772_11915
    TW20:
    SATW20_13040
    USA300_TCH1516:
    USA300HOU_1242
    VC40:
    SAVC_05745

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKIMNQFKEIYNTIEKLLNDKSISNYRINQDTDVSYGGISELRSGKRKVNNLTLETAEK
    NCTC8325        MTKIMNQFKEIYNTIEKLLNDKSISNYRINQDTDVSYGGISELRSGKRKVNNLTLETAEK
    USA300_FPR3757  ----MNQFKEIYNTIEKLLNDKSISNYRINQDTDVSYGGISELRSGKRKVNNLTLETAEK
                        ********************************************************

    COL             LYNYQKQLEIMIED
    NCTC8325        LYNYQKQLEIMIED
    USA300_FPR3757  LYNYQKQLEIMIED
                    **************