From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003641000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3971627..3974238
  • synteny block?: BlockID0027110
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1269
    08BA02176:
    11819-97:
    MS7_1271
    71193:
    ECT-R 2:
    ECTR2_1171
    ED133:
    ED98:
    SAAV_1291
    HO 5096 0412:
    SAEMRSA15_11480
    JH1:
    SaurJH1_1401
    JH9:
    SaurJH9_1373
    JKD6008:
    SAA6008_01269
    JKD6159:
    SAA6159_01170
    LGA251:
    M013:
    MRSA252:
    SAR1311
    MSHR1132:
    MSSA476:
    SAS1247
    Mu3:
    SAHV_1302
    Mu50:
    SAV1313
    MW2:
    MW1196
    RF122:
    ST398:
    T0131:
    SAT0131_01371
    TCH60:
    HMPREF0772_11907
    TW20:
    SATW20_13070
    USA300_TCH1516:
    USA300HOU_1248
    VC40:
    SAVC_05765

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLTLIKLKEDEQVIIYEYIPEDDISNGKGSVTFNKKDAEVIDFSLSEIENEEYFMLYRNK
    N315            MLTLIKLKEDEQVIIYEYIPEDDISNGKGSVTFNKKDAEVIDFSLSEIENEEYFMLYRNK
    NCTC8325        MLTLIKLKEDEQVIIYEYIPEDDISNGKGSVTFNKKDAEVIDFSLSEIENEEYFMLYRNK
    Newman          MLTLIKLKEDEQVIIYEYIPEDDISNGKGSVTFNKKDAEVIDFSLSEIENEEYFMLYRNK
    USA300_FPR3757  MLTLIKLKEDEQVIIYEYIPEDDISNGKGSVTFNKKDAEVIDFSLSEIENEEYFMLYRNK
                    ************************************************************

    COL             SFSVVRDFIEKQEFPENYKIAWY
    N315            SFSVVRDFIEKQEFPENYKIAWY
    NCTC8325        SFSVVRDFIEKQEFPENYKIAWY
    Newman          SFSVVRDFIEKQEFPENYKIAWY
    USA300_FPR3757  SFSVVRDFIEKQEFPENYKIAWY
                    ***********************