From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN003661000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3979331..3979579
  • synteny block?: BlockID0027300
  • occurrence?: in 38% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_11530
    JH1:
    JH9:
    JKD6008:
    SAA6008_01271
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR1320
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_01374
    TCH60:
    HMPREF0772_11899
    TW20:
    SATW20_13100
    USA300_TCH1516:
    USA300HOU_1250
    VC40:
    SAVC_05775

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLILKIKEINDKSVTYKYFPNNDENIKPGIIQMDIDSLEVINAEKSSLEKNTRDNYFIHA
    NCTC8325        MLILKIKEINDKSVTYKYFPNNDENIKPGIIQMDIDSLEVINAEKSSLEKNTRDNYFIHA
    Newman          MLILKIKEINDKSVTYKYFPNNDENIKPGIIQMDIDSLEVINAEKSSLEKNTRDNYFIHA
    USA300_FPR3757  MLILKIKEINDKSVTYKYFPNNDENIKPGIIQMDIDSLEVINAEKSSLEKNTRDNYFIHA
                    ************************************************************

    COL             IDRIYINTSKGLFPESELVAWG
    NCTC8325        IDRIYINTSKGLFPESELVAWG
    Newman          IDRIYINTSKGLFPESELVAWG
    USA300_FPR3757  IDRIYINTSKGLFPESELVAWG
                    **********************