From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003683000
  • symbol?: cls1
  • description?: cardiolipin synthetase-like protein

      descriptions from strain specific annotations:

    • cardiolipin synthetase-like protein
    • phospholipase D/transphosphatidylase
    • Cardiolipin synthetase
    • putative cardiolipin synthase
    • Cardiolipin synthase 1
    • cardiolipin synthetase (Cardiolipin synthase) (CLsynthase)
  • strand?: +
  • coordinates?: 3991512..3993032
  • synteny block?: BlockID0027490
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1351 (cls1)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1273
    08BA02176:
    C248_1356
    11819-97:
    MS7_1281
    71193:
    ST398NM01_1324
    ECT-R 2:
    ECTR2_1177
    ED133:
    SAOV_1331
    ED98:
    SAAV_1297
    HO 5096 0412:
    SAEMRSA15_11650
    JH1:
    SaurJH1_1406
    JH9:
    SaurJH9_1379
    JKD6008:
    SAA6008_01282 (cls1)
    JKD6159:
    SAA6159_01185 (cls1)
    LGA251:
    SARLGA251_12310
    M013:
    M013TW_1270
    MRSA252:
    SAR1328
    MSHR1132:
    SAMSHR1132_11630
    MSSA476:
    SAS1258
    Mu3:
    SAHV_1306
    Mu50:
    SAV1317
    MW2:
    MW1205
    RF122:
    SAB1180
    ST398:
    SAPIG1324
    T0131:
    SAT0131_01385
    TCH60:
    HMPREF0772_11890 (cls2)
    TW20:
    SATW20_13200
    USA300_TCH1516:
    USA300HOU_1262 (cls)
    VC40:
    SAVC_05830

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------------MRFTFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWL
    N315            MFFVPFFIGEKTMRYTFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWL
    NCTC8325        ------------MRFTFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWL
    Newman          ---MPFFIGEKTMRFTFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWL
    USA300_FPR3757  ------------MRFTFSNDLGTLFTIILAIGFIINLVLAFIIIFLERNRRTASSTWAWL
                                **:*********************************************

    COL             FVLFVLPLIGFILYLFFGRTVSARKLNKNNGNVLTDFDGLLKQQIESFDKGNYGTDNKQV
    N315            FVLFVLPLIGFILYLFFGRTVSARKLNKNNGNVLTDFDGLLKQQIESFDKGNYGTDNKQV
    NCTC8325        FVLFVLPLIGFILYLFFGRTVSARKLNKNNGNVLTDFDGLLKQQIESFDKGNYGTDNKQV
    Newman          FVLFVLPLIGFILYLFFGRTVSARKLNKNNGNVLTDFDGLLKQQIESFDKGNYGTDNKQV
    USA300_FPR3757  FVLFVLPLIGFILYLFFGRTVSARKLNKNNGNVLTDFDGLLKQQIESFDKGNYGTDNKQV
                    ************************************************************

    COL             QKHHDLVRMLLMDQDGFLTENNKVDHFIDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGL
    N315            QKHHDLVSMLLMDQDGFLTENNKVDHFIDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGL
    NCTC8325        QKHHDLVRMLLMDQDGFLTENNKVDHFIDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGL
    Newman          QKHHDLVRMLLMDQDGFLTENNKVDHFIDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGL
    USA300_FPR3757  QKHHDLVRMLLMDQDGFLTENNKVDHFIDGNDLYDQVLKDIKNAKEYIHLEYYTFALDGL
                    ******* ****************************************************

    COL             GKRILHALEEKLKQGLEVKILYDDVGSKNVKMANFDHFKSLGGEVEAFFASKLPLLNFRM
    N315            GKRILHALEEKLKQGLEVKILYDDVGSKNVKMANFDHFKSLGGEVEAFFASKLPLLNFRM
    NCTC8325        GKRILHALEEKLKQGLEVKILYDDVGSKNVKMANFDHFKSLGGEVEAFFASKLPLLNFRM
    Newman          GKRILHALEEKLKQGLEVKILYDDVGSKNVKMANFDHFKSLGGEVEAFFASKLPLLNFRM
    USA300_FPR3757  GKRILHALEEKLKQGLEVKILYDDVGSKNVKMANFDHFKSLGGEVEAFFASKLPLLNFRM
                    ************************************************************

    COL             NNRNHRKIIVIDGQLGYVGGFNIGDEYLGLGKLGYWRDTHLRIQGDAVDALQLRFILDWN
    N315            NNRNHRKIIVIDGQLGYVGGFNIGDEYLGLGKLGYWRDTHLRIQGDAVDALQLRFILDWN
    NCTC8325        NNRNHRKIIVIDGQLGYVGGFNIGDEYLGLGKLGYWRDTHLRIQGDAVDALQLRFILDWN
    Newman          NNRNHRKIIVIDGQLGYVGGFNIGDEYLGLGKLGYWRDTHLRIQGDAVDALQLRFILDWN
    USA300_FPR3757  NNRNHRKIIVIDGQLGYVGGFNIGDEYLGLGKLGYWRDTHLRIQGDAVDALQLRFILDWN
                    ************************************************************

    COL             SQAHRPQFEYDVKYFPKKNGPLGNSPIQIAASGPASDWHQIEYGYTKMIMSAKKSVYLQS
    N315            SQAHRPQFEYDVKYFPKKNGPLGNSPIQIAASGPASDWHQIEYGYTKMIMSAKKSVYLQS
    NCTC8325        SQAHRPQFEYDVKYFPKKNGPLGNSPIQIAASGPASDWHQIEYGYTKMIMSAKKSVYLQS
    Newman          SQAHRPQFEYDVKYFPKKNGPLGNSPIQIAASGPASDWHQIEYGYTKMIMSAKKSVYLQS
    USA300_FPR3757  SQAHRPQFEYDVKYFPKKNGPLGNSPIQIAASGPASDWHQIEYGYTKMIMSAKKSVYLQS
                    ************************************************************

    COL             PYFIPDNSYINAIKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLSSGVKIYTYENG
    N315            PYFIPDNSYINAIKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLSSGVKIYTYENG
    NCTC8325        PYFIPDNSYINAIKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLSSGVKIYTYENG
    Newman          PYFIPDNSYINAIKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLSSGVKIYTYENG
    USA300_FPR3757  PYFIPDNSYINAIKIAAKSGVDVHLMIPCKPDHPLVYWATFSNASDLLSSGVKIYTYENG
                    ************************************************************

    COL             FIHSKMCLIDDEIVSVGTANMDFRSFELNFEVNAFVYDENLAKDLRVAYEHDITKSKQLT
    N315            FIHSKMCLIDDEIVSVGTANMDFRSFELNFEVNAFVYDENLAKDLRVAYEHDITKSKQLT
    NCTC8325        FIHSKMCLIDDEIVSVGTANMDFRSFELNFEVNAFVYDENLAKDLRVAYEHDITKSKQLT
    Newman          FIHSKMCLIDDEIVSVGTANMDFRSFELNFEVNAFVYDENLAKDLRVAYEHDITKSKQLT
    USA300_FPR3757  FIHSKMCLIDDEIVSVGTANMDFRSFELNFEVNAFVYDENLAKDLRVAYEHDITKSKQLT
                    ************************************************************

    COL             KESYANRPLSVKFKESLAKLVSPIL
    N315            KESYANRPLSVKFKESLAKLVSPIL
    NCTC8325        KESYANRPLSVKFKESLAKLVSPIL
    Newman          KESYANRPLSVKFKESLAKLVSPIL
    USA300_FPR3757  KESYANRPLSVKFKESLAKLVSPIL
                    *************************